In [16]:
 
# add the scripts/libraries for the blast parser into the Python library path
import sys
sys.path.append('/usr/local/notebooks/lib')

This shows the current working directory (think: print working directory)

In [17]:
 
!pwd
/mnt

First, go to the temporary disk space.

In [18]:
 
cd /mnt
/mnt
In [19]:
 
ls
blast-2.2.24/                   mouse.protein.faa.psi
blast-2.2.24-ia32-linux.tar.gz  mouse.protein.faa.psq
formatdb.log                    out.txt
lost+found/                     zebrafish.protein.faa
mm-first.fa                     zebrafish.protein.faa.phr
mouse.protein.faa               zebrafish.protein.faa.pin
mouse.protein.faa.phr           zebrafish.protein.faa.pnd
mouse.protein.faa.pin           zebrafish.protein.faa.pni
mouse.protein.faa.pnd           zebrafish.protein.faa.psd
mouse.protein.faa.pni           zebrafish.protein.faa.psi
mouse.protein.faa.psd           zebrafish.protein.faa.psq

A Random Header

Now I can type all sorts of things in here and they will be nicely formatted when I hit shift-ENTER.

I think you can also do equations x=1y

Let's check out the disks on this baby.

In [20]:
 
!df
Filesystem           1K-blocks      Used Available Use% Mounted on
/dev/xvda1            10321208   3381212   6415720  35% /
udev                   3815928         4   3815924   1% /dev
tmpfs                  1529508       164   1529344   1% /run
none                      5120         0      5120   0% /run/lock
none                   3823768         0   3823768   0% /run/shm
/dev/xvdb1           433455904    387188 411050412   1% /mnt

Second, install BLAST.

Here, we're using curl to download the BLAST distribution from NCBI; then we're using 'tar' to unpack it into the current directory; and then we're copying the program files into the directory /usr/local/bin, where we can run them from anywhere.

In [21]:
 
!curl -O ftp://ftp.ncbi.nih.gov/blast/executables/release/2.2.24/blast-2.2.24-ia32-linux.tar.gz
!tar xzf blast-2.2.24-ia32-linux.tar.gz
!cp blast-2.2.24/bin/* /usr/local/bin
!cp -r blast-2.2.24/data /usr/local/blast-data
  % Total    % Received % Xferd  Average Speed   Time    Time     Time  Current
                                 Dload  Upload   Total   Spent    Left  Speed

  0     0    0     0    0     0      0      0 --:--:-- --:--:-- --:--:--     0
 32 34.1M   32 11.0M    0     0  16.6M      0  0:00:02 --:--:--  0:00:02 17.6M
100 34.1M  100 34.1M    0     0  26.6M      0  0:00:01  0:00:01 --:--:-- 27.3M

Once we have BLAST installed, we can run it to see what options there are.

In [22]:
 
!blastall
blastall 2.2.24   arguments:

  -p  Program Name [String]
  -d  Database [String]
    default = nr
  -i  Query File [File In]
    default = stdin
  -e  Expectation value (E) [Real]
    default = 10.0
  -m  alignment view options:
0 = pairwise,
1 = query-anchored showing identities,
2 = query-anchored no identities,
3 = flat query-anchored, show identities,
4 = flat query-anchored, no identities,
5 = query-anchored no identities and blunt ends,
6 = flat query-anchored, no identities and blunt ends,
7 = XML Blast output,
8 = tabular, 
9 tabular with comment lines
10 ASN, text
11 ASN, binary [Integer]
    default = 0
    range from 0 to 11
  -o  BLAST report Output File [File Out]  Optional
    default = stdout
  -F  Filter query sequence (DUST with blastn, SEG with others) [String]
    default = T
  -G  Cost to open a gap (-1 invokes default behavior) [Integer]
    default = -1
  -E  Cost to extend a gap (-1 invokes default behavior) [Integer]
    default = -1
  -X  X dropoff value for gapped alignment (in bits) (zero invokes default behavior)
      blastn 30, megablast 20, tblastx 0, all others 15 [Integer]
    default = 0
  -I  Show GI's in deflines [T/F]
    default = F
  -q  Penalty for a nucleotide mismatch (blastn only) [Integer]
    default = -3
  -r  Reward for a nucleotide match (blastn only) [Integer]
    default = 1
  -v  Number of database sequences to show one-line descriptions for (V) [Integer]
    default = 500
  -b  Number of database sequence to show alignments for (B) [Integer]
    default = 250
  -f  Threshold for extending hits, default if zero
      blastp 11, blastn 0, blastx 12, tblastn 13
      tblastx 13, megablast 0 [Real]
    default = 0
  -g  Perform gapped alignment (not available with tblastx) [T/F]
    default = T
  -Q  Query Genetic code to use [Integer]
    default = 1
  -D  DB Genetic code (for tblast[nx] only) [Integer]
    default = 1
  -a  Number of processors to use [Integer]
    default = 1
  -O  SeqAlign file [File Out]  Optional
  -J  Believe the query defline [T/F]
    default = F
  -M  Matrix [String]
    default = BLOSUM62
  -W  Word size, default if zero (blastn 11, megablast 28, all others 3) [Integer]
    default = 0
  -z  Effective length of the database (use zero for the real size) [Real]
    default = 0
  -K  Number of best hits from a region to keep. Off by default.
If used a value of 100 is recommended.  Very high values of -v or -b is also suggested [Integer]
    default = 0
  -P  0 for multiple hit, 1 for single hit (does not apply to blastn) [Integer]
    default = 0
  -Y  Effective length of the search space (use zero for the real size) [Real]
    default = 0
  -S  Query strands to search against database (for blast[nx], and tblastx)
       3 is both, 1 is top, 2 is bottom [Integer]
    default = 3
  -T  Produce HTML output [T/F]
    default = F
  -l  Restrict search of database to list of GI's [String]  Optional
  -U  Use lower case filtering of FASTA sequence [T/F]  Optional
  -y  X dropoff value for ungapped extensions in bits (0.0 invokes default behavior)
      blastn 20, megablast 10, all others 7 [Real]
    default = 0.0
  -Z  X dropoff value for final gapped alignment in bits (0.0 invokes default behavior)
      blastn/megablast 100, tblastx 0, all others 25 [Integer]
    default = 0
  -R  PSI-TBLASTN checkpoint file [File In]  Optional
  -n  MegaBlast search [T/F]
    default = F
  -L  Location on query sequence [String]  Optional
  -A  Multiple Hits window size, default if zero (blastn/megablast 0, all others 40 [Integer]
    default = 0
  -w  Frame shift penalty (OOF algorithm for blastx) [Integer]
    default = 0
  -t  Length of the largest intron allowed in a translated nucleotide sequence when linking multiple distinct alignments. (0 invokes default behavior; a negative value disables linking.) [Integer]
    default = 0
  -B  Number of concatenated queries, for blastn and tblastn [Integer]  Optional
    default = 0
  -V  Force use of the legacy BLAST engine [T/F]  Optional
    default = F
  -C  Use composition-based score adjustments for blastp or tblastn:
      As first character:
      D or d: default (equivalent to T)
      0 or F or f: no composition-based statistics
      2 or T or t: Composition-based score adjustments as in Bioinformatics 21:902-911,
      1: Composition-based statistics as in NAR 29:2994-3005, 2001
          2005, conditioned on sequence properties
      3: Composition-based score adjustment as in Bioinformatics 21:902-911,
          2005, unconditionally
      For programs other than tblastn, must either be absent or be D, F or 0.
           As second character, if first character is equivalent to 1, 2, or 3:
      U or u: unified p-value combining alignment p-value and compositional p-value in round 1 only
 [String]
    default = D
  -s  Compute locally optimal Smith-Waterman alignments (This option is only
      available for gapped tblastn.) [T/F]
    default = F

So, let's actually do something! Let's try BLASTing the first few sequences of the mouse RefSeq proteome against the zebrafish protein.

Before we run BLAST, we need to get the FASTA files, then uncompress them.

In [23]:
 
!curl -O ftp://ftp.ncbi.nih.gov/refseq/M_musculus/mRNA_Prot/mouse.protein.faa.gz
!curl -O ftp://ftp.ncbi.nih.gov/refseq/D_rerio/mRNA_Prot/zebrafish.protein.faa.gz
  % Total    % Received % Xferd  Average Speed   Time    Time     Time  Current
                                 Dload  Upload   Total   Spent    Left  Speed

  0     0    0     0    0     0      0      0 --:--:-- --:--:-- --:--:--     0
100 8923k  100 8923k    0     0  15.6M      0 --:--:-- --:--:-- --:--:-- 15.8M
  % Total    % Received % Xferd  Average Speed   Time    Time     Time  Current
                                 Dload  Upload   Total   Spent    Left  Speed

  0     0    0     0    0     0      0      0 --:--:-- --:--:-- --:--:--     0
100 8730k  100 8730k    0     0  16.6M      0 --:--:-- --:--:-- --:--:-- 16.8M

Here, you can see all of the files we've downloaded:

In [24]:
 
!ls -l
total 126352
drwxr-xr-x 5 3755 5333     4096 2010-08-08 14:25 blast-2.2.24
-rw-r--r-- 1 root root 35780218 2012-06-05 17:30 blast-2.2.24-ia32-linux.tar.gz
-rw-r--r-- 1 root root      466 2012-06-05 15:38 formatdb.log
drwx------ 2 root root    16384 2011-07-13 09:38 lost+found
-rw-r--r-- 1 root root      857 2012-06-05 15:37 mm-first.fa
-rw-r--r-- 1 root root 18256603 2012-06-05 17:27 mouse.protein.faa
-rw-r--r-- 1 root root  9137384 2012-06-05 17:30 mouse.protein.faa.gz
-rw-r--r-- 1 root root  3566300 2012-06-05 15:38 mouse.protein.faa.phr
-rw-r--r-- 1 root root   231400 2012-06-05 15:38 mouse.protein.faa.pin
-rw-r--r-- 1 root root   231320 2012-06-05 15:38 mouse.protein.faa.pnd
-rw-r--r-- 1 root root      948 2012-06-05 15:38 mouse.protein.faa.pni
-rw-r--r-- 1 root root  1024064 2012-06-05 15:38 mouse.protein.faa.psd
-rw-r--r-- 1 root root    22374 2012-06-05 15:38 mouse.protein.faa.psi
-rw-r--r-- 1 root root 15594018 2012-06-05 15:38 mouse.protein.faa.psq
-rw-r--r-- 1 root root     6347 2012-06-05 15:38 out.txt
-rw-r--r-- 1 root root 16993873 2012-06-05 17:28 zebrafish.protein.faa
-rw-r--r-- 1 root root  8940147 2012-06-05 17:30 zebrafish.protein.faa.gz
-rw-r--r-- 1 root root  3436310 2012-06-05 15:37 zebrafish.protein.faa.phr
-rw-r--r-- 1 root root   218416 2012-06-05 15:38 zebrafish.protein.faa.pin
-rw-r--r-- 1 root root   218328 2012-06-05 15:37 zebrafish.protein.faa.pnd
-rw-r--r-- 1 root root      900 2012-06-05 15:37 zebrafish.protein.faa.pni
-rw-r--r-- 1 root root  1025629 2012-06-05 15:37 zebrafish.protein.faa.psd
-rw-r--r-- 1 root root    23771 2012-06-05 15:38 zebrafish.protein.faa.psi
-rw-r--r-- 1 root root 14409654 2012-06-05 15:37 zebrafish.protein.faa.psq
In [25]:
 
!ls *.faa.gz
mouse.protein.faa.gz  zebrafish.protein.faa.gz

Uncompress 'em.

In [26]:
 
!gunzip -f *.faa.gz
!ls
blast-2.2.24			mouse.protein.faa.psi
blast-2.2.24-ia32-linux.tar.gz	mouse.protein.faa.psq
formatdb.log			out.txt
lost+found			zebrafish.protein.faa
mm-first.fa			zebrafish.protein.faa.phr
mouse.protein.faa		zebrafish.protein.faa.pin
mouse.protein.faa.phr		zebrafish.protein.faa.pnd
mouse.protein.faa.pin		zebrafish.protein.faa.pni
mouse.protein.faa.pnd		zebrafish.protein.faa.psd
mouse.protein.faa.pni		zebrafish.protein.faa.psi
mouse.protein.faa.psd		zebrafish.protein.faa.psq

Let's use the 'head' command to look at the first few sequences. This takes the first 10 lines of a text file and prints them out.

Note that you can also specify a specific number of lines using '-' -- e.g. 'head -15 filename.txt' will print out the first 15 lines.

In [27]:
 
!head -11 mouse.protein.faa
>gi|83029092|ref|XP_357633.3| PREDICTED: similar to Ig kappa chain V-V region L7 precursor [Mus musculus]
MRSLPASELSLPYHQDFRPDSSCPGLTDNHLLCEPTQKPRYPDLGRKRSGENRHRYRDVCISFIRRSFSALCHNPQKLRE
NLKMVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISG
IPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPPTMMQTIAKTSRKAEVRG
>gi|70778726|ref|NP_067474.2| WD repeat domain 8 [Mus musculus]
MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLYTCLDQIQHIEWSADSLFILCAMYRRGLVQVWSLEQ
PEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYV
SIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAI
GSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTL
KPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLW
SPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFCLCFLETKERVGTAYEQRDGMPRT

Let's take the first 11 lines (through to the end of the second sequence -- I know because I cheated) and put them in a new file. This way we can play with a subset of the data, which is always a good idea when you have lots of data!

In [28]:
 
!head -11 mouse.protein.faa > mm-first.fa

Now, format the FASTA files for BLAST. This makes it easy for BLAST to search them quickly.

Note, you can use 'formatdb -i filename -o T -p F' to format nucleotide databases.

In [29]:
 
!formatdb -i zebrafish.protein.faa -o T -p T
!formatdb -i mouse.protein.faa -o T -p T

And now... run a BLAST!

In [30]:
 
!blastall -i mm-first.fa -d zebrafish.protein.faa -p blastp
BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|83029092|ref|XP_357633.3| PREDICTED: similar to Ig kappa
chain V-V region L7 precursor [Mus musculus]
         (216 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_001038873.1| uncharacterized protein LOC751695 precursor ...    74   6e-14
ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [D...    74   1e-13
ref|XP_003201396.1| PREDICTED: ig kappa chain V-I region Scw-lik...    69   3e-12
ref|XP_002665586.1| PREDICTED: ig kappa chain V-III region B6 [D...    67   7e-12
ref|XP_003201398.1| PREDICTED: ig kappa chain V-III region B6-li...    67   1e-11
ref|XP_001920187.2| PREDICTED: hypothetical protein LOC100150116...    65   4e-11
ref|XP_003201399.1| PREDICTED: ig kappa chain V19-17-like [Danio...    62   2e-10
ref|XP_003200636.1| PREDICTED: ig kappa chain V-I region WEA-lik...    54   8e-08
ref|NP_001020667.1| novel immune-type receptor 12 precursor [Dan...    47   1e-05
ref|XP_001923479.1| PREDICTED: hypothetical protein LOC100151290...    46   2e-05
ref|XP_003200433.1| PREDICTED: t-cell receptor beta chain T17T-2...    38   0.005
ref|XP_003198184.1| PREDICTED: ig heavy chain V-I region HG3-lik...    37   0.011
ref|XP_003197959.1| PREDICTED: hypothetical protein LOC100535098...    37   0.015
ref|XP_003197951.1| PREDICTED: ig kappa chain V-III region VH-li...    36   0.020
ref|XP_003197960.1| PREDICTED: hypothetical protein LOC100535742...    36   0.020
ref|XP_003197945.1| PREDICTED: ig lambda chain V-II region BO-li...    36   0.020
ref|NP_001005768.1| novel immune-type receptor 5 precursor [Dani...    35   0.028
ref|XP_003197957.1| PREDICTED: immunoglobulin omega chain-like [...    35   0.028
ref|XP_002666277.1| PREDICTED: hypothetical protein LOC100331885...    35   0.029
ref|NP_001018511.1| ganglioside-induced differentiation-associat...    35   0.053
ref|NP_954581.3| novel immune-type receptor 6a precursor [Danio ...    35   0.057
ref|XP_003198968.1| PREDICTED: hypothetical protein LOC100538107...    34   0.082
ref|XP_003197944.1| PREDICTED: ig kappa chain V-VI region NQ2-6....    34   0.086
ref|NP_001121856.1| novel immune-type receptor 13 isoform 1 prec...    33   0.11 
ref|NP_001232002.1| similar to novel immune-type receptor 5, all...    33   0.12 
ref|XP_003201256.1| PREDICTED: basement membrane-specific hepara...    33   0.13 
ref|NP_001020668.1| novel immune-type receptor 11b precursor [Da...    33   0.14 
ref|XP_001331043.4| PREDICTED: hypothetical protein LOC791658 [D...    33   0.16 
ref|XP_003198238.1| PREDICTED: ig lambda chain V-III region LOI-...    33   0.16 
ref|XP_003198962.1| PREDICTED: hypothetical protein LOC100537152...    33   0.19 
ref|XP_002666721.1| PREDICTED: hypothetical protein LOC100332522...    33   0.20 
ref|XP_003198969.1| PREDICTED: hypothetical protein LOC100538145...    33   0.20 
ref|NP_001020672.1| novel immune-type receptor 11a precursor [Da...    32   0.26 
ref|NP_938160.1| immune-type receptor 1o [Danio rerio]                 32   0.26 
ref|XP_003198963.1| PREDICTED: hypothetical protein LOC100537250...    32   0.27 
ref|XP_003197958.1| PREDICTED: ig lambda chain V-VI region AR-li...    32   0.31 
ref|NP_001018173.1| novel immune-type receptor 1b precursor [Dan...    32   0.36 
ref|NP_001135740.1| immune-type receptor 5-like precursor [Danio...    32   0.40 
ref|XP_003198961.1| PREDICTED: hypothetical protein LOC100537054...    32   0.40 
ref|XP_001333297.2| PREDICTED: hypothetical protein LOC794617 is...    32   0.41 
ref|XP_003197933.1| PREDICTED: hypothetical protein LOC100534730...    32   0.42 
ref|NP_001032660.1| novel immune-type receptor 1n precursor [Dan...    32   0.48 
ref|XP_001921797.2| PREDICTED: LOW QUALITY PROTEIN: hypothetical...    32   0.48 
ref|XP_001333206.2| PREDICTED: hypothetical protein LOC794617 is...    31   0.50 
ref|XP_003197949.1| PREDICTED: immunoglobulin iota chain-like [D...    31   0.53 
ref|NP_938161.1| novel immune-type receptor 1l precursor [Danio ...    31   0.62 
ref|NP_001186301.1| uncharacterized protein LOC100331689 precurs...    31   0.62 
ref|NP_938155.1| novel immune-type receptor 1m precursor [Danio ...    31   0.63 
ref|NP_938162.1| novel immune-type receptor 1k precursor [Danio ...    31   0.64 
ref|XP_003197946.1| PREDICTED: immunoglobulin omega chain-like [...    31   0.64 
ref|XP_002662802.1| PREDICTED: hypothetical protein LOC100330879...    31   0.66 
ref|XP_002661242.2| PREDICTED: ig heavy chain V-III region HIL [...    31   0.75 
ref|XP_002667279.1| PREDICTED: hypothetical protein LOC100330441...    31   0.77 
ref|XP_003197952.1| PREDICTED: immunoglobulin omega chain-like [...    31   0.80 
ref|NP_571547.1| vascular endothelial growth factor receptor kdr...    31   0.82 
ref|XP_001920377.3| PREDICTED: b-cell receptor CD22-like [Danio ...    31   0.85 
ref|NP_001011881.1| novel immune-type receptor 1j precursor [Dan...    30   0.88 
ref|NP_571721.1| novel immune-type receptor 1i [Danio rerio]           30   0.90 
ref|XP_003197934.1| PREDICTED: hypothetical protein LOC100534813...    30   0.92 
ref|XP_003197935.1| PREDICTED: ig heavy chain V-III region CAM-l...    30   0.94 
ref|XP_003197820.1| PREDICTED: hypothetical protein LOC100537163...    30   0.98 
ref|XP_003201143.1| PREDICTED: hypothetical protein LOC100537953...    30   1.00 
ref|NP_938163.1| novel immune-type receptor 1d precursor [Danio ...    30   1.2  
ref|XP_003197947.1| PREDICTED: immunoglobulin omega chain-like [...    30   1.2  
ref|NP_938164.1| novel immune-type receptor 1c precursor [Danio ...    30   1.3  
ref|NP_938169.1| novel immune-type receptor 3d isoform 1 precurs...    30   1.3  
ref|NP_001120804.1| secreted immunoglobulin domain 1 precursor [...    30   1.4  
ref|NP_001245248.1| diverse immunoglobulin domain-containing pro...    30   1.5  
ref|XP_001923759.3| PREDICTED: hypothetical protein LOC100004978...    30   1.6  
ref|NP_938168.1| novel immune-type receptor 3d isoform 2 precurs...    30   1.6  
ref|NP_001007212.1| novel immune-type receptor 3b [Danio rerio]        30   1.9  
ref|NP_991212.1| uncharacterized protein LOC402947 [Danio rerio]       29   2.0  
ref|NP_571727.1| novel immune-type receptor 3a precursor [Danio ...    29   2.2  
ref|NP_001007203.1| novel immune-type receptor precursor [Danio ...    29   2.4  
ref|XP_001921605.2| PREDICTED: hypothetical protein LOC559375 [D...    29   2.7  
ref|XP_002663948.1| PREDICTED: hypothetical protein LOC100329481...    29   2.8  
ref|NP_001153138.1| immunoglobulin superfamily member 3 precurso...    29   2.9  
ref|XP_003197821.1| PREDICTED: polymeric immunoglobulin receptor...    29   2.9  
ref|NP_694508.1| mucosa associated lymphoid tissue lymphoma tran...    29   3.0  
ref|NP_001245161.1| diverse immunoglobulin domain-containing pro...    29   3.2  
ref|NP_001018172.1| novel immune-type receptor 2a precursor [Dan...    29   3.2  
ref|NP_001005578.1| novel immune-type receptor 7b precursor [Dan...    28   3.3  
ref|XP_001342685.4| PREDICTED: hypothetical protein LOC100003040...    28   3.5  
ref|XP_003201336.1| PREDICTED: hypothetical protein LOC100537913...    28   3.7  
ref|NP_001007220.1| novel immune-type receptor 1a precursor [Dan...    28   4.0  
ref|XP_003200226.1| PREDICTED: hypothetical protein LOC100006926...    28   4.0  
ref|NP_001005576.1| novel immune-type receptor 9 precursor [Dani...    28   4.3  
ref|XP_003197826.1| PREDICTED: CMRF35-like molecule 9-like [Dani...    28   4.4  
ref|XP_001923800.1| PREDICTED: titin [Danio rerio]                     28   4.4  
ref|NP_001073429.2| matrix-remodelling associated 8b precursor [...    28   5.2  
ref|XP_003200434.1| PREDICTED: hypothetical protein LOC100534684...    28   5.4  
ref|NP_956958.1| cell adhesion molecule 2a precursor [Danio rerio]     28   5.5  
ref|XP_003197943.1| PREDICTED: immunoglobulin omega chain-like [...    28   6.3  
ref|XP_002662355.1| PREDICTED: myosin light chain kinase, smooth...    28   6.5  
ref|NP_001018542.1| uncharacterized protein LOC553735 [Danio rerio]    28   6.9  
ref|NP_571730.1| novel immune-type receptor 4a isoform 2 precurs...    28   7.0  
ref|NP_001007293.1| novel immune-type receptor 1f precursor [Dan...    28   7.1  
ref|XP_684938.3| PREDICTED: butyrophilin subfamily 2 member A2-l...    28   7.2  
ref|NP_001120726.1| novel immune-type receptor 13 isoform 2 prec...    27   7.3  
ref|XP_001341831.3| PREDICTED: hypothetical protein LOC100001930...    27   7.5  
ref|XP_003199104.1| PREDICTED: leucine-rich repeat neuronal prot...    27   7.7  
ref|XP_001922166.2| PREDICTED: e3 ubiquitin-protein ligase TRIM2...    27   7.8  
ref|XP_003197961.1| PREDICTED: CMRF35-like molecule 5-like [Dani...    27   7.8  
ref|XP_002667765.2| PREDICTED: butyrophilin-like protein 2-like ...    27   8.0  
ref|XP_003199219.1| PREDICTED: myosin light chain kinase, smooth...    27   8.6  
ref|NP_001018583.1| leucine rich repeat containing 4C precursor ...    27   8.7  
ref|XP_003197822.1| PREDICTED: polymeric immunoglobulin receptor...    27   9.0  
ref|XP_003201334.1| PREDICTED: butyrophilin subfamily 2 member A...    27   9.1  
ref|XP_003198941.1| PREDICTED: b-cell receptor CD22-like [Danio ...    27   9.4  
ref|XP_684768.2| PREDICTED: butyrophilin-like protein 8-like [Da...    27   9.5  
ref|XP_001340824.2| PREDICTED: butyrophilin-like protein 8-like ...    27   9.7  

>ref|NP_001038873.1| uncharacterized protein LOC751695 precursor [Danio rerio]
          Length = 238

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (52%), Gaps = 7/110 (6%)

Query: 94  LLFWTSASRCD-----IVMTQSPATLSVTPGDRVSLSCRASQS--ISDYLHWYQQKSHES 146
           +L WT A+ C      + +TQ+P+ L   PG  +++ CR S+      Y+ WY QK  E+
Sbjct: 6   ILIWTLAALCGECIGQVTVTQTPSVLLSEPGQSLTVHCRLSRDPVCCYYVSWYLQKPGEA 65

Query: 147 PRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
           P+LLI Y +                 DFTLSI+ V+ ED G YYCQ+ HS
Sbjct: 66  PKLLIYYTTVLQSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQSYHS 115


>ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [Danio rerio]
          Length = 270

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 55/96 (57%), Gaps = 5/96 (5%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSIS---DYLHWYQQKSHESPRLLIKYASQ--XXX 159
           + +TQSPA  S+T G+ +++SC+ SQ IS   D + WYQQK  E+P+LLI Y S      
Sbjct: 55  VTVTQSPAVRSITQGETLTISCKTSQPISDCNDCVSWYQQKPGETPKLLIYYISSPYSNT 114

Query: 160 XXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
                        DFTLSI+ V+ ED G YYC + H
Sbjct: 115 PSRFSGGGSDYGSDFTLSISGVQTEDAGDYYCLSYH 150


>ref|XP_003201396.1| PREDICTED: ig kappa chain V-I region Scw-like [Danio rerio]
          Length = 132

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 55/109 (50%), Gaps = 7/109 (6%)

Query: 94  LLFWTSASRCD-----IVMTQSPATLSVTPGDRVSLSCRASQSISDYLH--WYQQKSHES 146
           +L WT A+ C      + +TQ+P+ L   PG  +++ CR S +     H  WY QK  E+
Sbjct: 14  ILIWTLAALCGECIGQVTVTQTPSVLLSEPGRSLTVHCRFSSNPDCCYHVSWYLQKPGEA 73

Query: 147 PRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
           P+LLI Y                   DFTLSI+ V+ ED G YYCQ+ H
Sbjct: 74  PKLLIYYTDVLQPGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQSYH 122


>ref|XP_002665586.1| PREDICTED: ig kappa chain V-III region B6 [Danio rerio]
          Length = 183

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%)

Query: 108 TQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXX 167
            QSP  LS+  G+  S+SC  +  + + + WY QK  ++P+LLI   S            
Sbjct: 89  VQSPECLSIQAGESASISCSGTSGVGNDMSWYLQKPGKAPKLLIYGISHLEPGVSDRFIG 148

Query: 168 XXXXXDFTLSINSVEPEDVGVYYCQN 193
                DFTL+I +V+PED GVYYC  
Sbjct: 149 SGSEPDFTLNIRAVQPEDAGVYYCMG 174


>ref|XP_003201398.1| PREDICTED: ig kappa chain V-III region B6-like [Danio rerio]
          Length = 125

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 93  LLLFWT-----SASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDY----LHWYQQKS 143
           ++  WT     S     I +TQSP   +V PG+ V +SC+ S S +      + WY QK 
Sbjct: 5   IIFIWTLSFCFSGCAAQITVTQSPVE-TVKPGENVQMSCKLSSSETGCYPPCVSWYLQKP 63

Query: 144 HESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
            E+P+LLI   S                 DFTLSI+ V+ ED G YYCQ+ H
Sbjct: 64  GEAPKLLIYRTSSRQSGTASRFSGSGSNVDFTLSISGVQTEDAGHYYCQSRH 115


>ref|XP_001920187.2| PREDICTED: hypothetical protein LOC100150116 [Danio rerio]
          Length = 246

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (54%), Gaps = 5/95 (5%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQ--SISDY--LHWYQQKSHESPRLLIKYASQXXXX 160
           I +TQSP    V PG+ V + C+ +Q  + S Y  L+WY QK  E+P+LLI Y ++    
Sbjct: 143 ITVTQSPVE-PVKPGENVEMRCKLNQYSNCSPYPCLYWYLQKPGEAPKLLIYYVNRLQSG 201

Query: 161 XXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
                       DFTLSI+ V+ ED G YYC + H
Sbjct: 202 TASRFSGSGSHVDFTLSISGVQTEDAGHYYCMSLH 236



 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           DFTLSI+ V+ ED G YY Q
Sbjct: 123 DFTLSISGVQTEDAGHYYSQ 142


>ref|XP_003201399.1| PREDICTED: ig kappa chain V19-17-like [Danio rerio]
          Length = 124

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQ----SISDYLHWYQQKSHESPRLLIKYASQXXXX 160
           I +TQ P    V PG+ V +SC+ SQ    S    + WY QK  E P+LLI   S     
Sbjct: 24  ITVTQIPVE-PVKPGENVQMSCKLSQPAPCSPKPCVSWYLQKPGEDPKLLIYVTSYRYSG 82

Query: 161 XXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
                       DFTLSI+ V+ ED G YYCQ+ HS
Sbjct: 83  TASRFSGSGSNVDFTLSISGVQTEDAGHYYCQSYHS 118


>ref|XP_003200636.1| PREDICTED: ig kappa chain V-I region WEA-like [Danio rerio]
          Length = 116

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%)

Query: 108 TQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXX 167
            QSP +LSV  GD  S+SC  +  +   + WY QK  ++P+LLI   S            
Sbjct: 22  VQSPESLSVKAGDSASISCTGTSGVGYDMSWYLQKPGKAPKLLIYGVSYLESGVSDRFSG 81

Query: 168 XXXXXDFTLSINSVEPEDV 186
                 FTL+I  V+PED 
Sbjct: 82  NGSEPAFTLNIRGVQPEDA 100


>ref|NP_001020667.1| novel immune-type receptor 12 precursor [Danio rerio]
          Length = 318

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 90  LLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRL 149
           L+  LLF T  S     + Q     S T G  V+L C  S ++ +Y  W++Q   E+P  
Sbjct: 6   LVYFLLFRTGFSG---AVVQKKVLESFTAGQTVTLECLISVNLENYFSWFKQTLGEAPTC 62

Query: 150 LIKYASQXXX-------XXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++   ++                        F L+I   +P D G+YYC
Sbjct: 63  IVSLYAESSTPVFYGEFKNNHRMSVQKEKNTFVLNIKEAKPSDAGIYYC 111


>ref|XP_001923479.1| PREDICTED: hypothetical protein LOC100151290 [Danio rerio]
          Length = 318

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 43/109 (39%), Gaps = 10/109 (9%)

Query: 90  LLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRL 149
           L+  LLF T  S   I   Q     S T G  V+L C  S ++ +Y  W++Q   E+P  
Sbjct: 6   LVYFLLFRTGFSGAVI---QKKVLESFTAGQTVTLECLISLNLENYFSWFKQTLGEAPTC 62

Query: 150 LIKYASQXXX-------XXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++   ++                        F L I   +P D G+YYC
Sbjct: 63  IVSLYAESSTPVFYGEFKNNHRMSVQKGKNTFVLIIKEAKPSDAGIYYC 111


>ref|XP_003200433.1| PREDICTED: t-cell receptor beta chain T17T-22-like [Danio rerio]
          Length = 275

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLL 150
           +++TQ P  +S  PG  V + C  + +  DY +WY+Q   E P L+
Sbjct: 9   VLITQWPKYISSLPGFSVDMHCYQNDTDYDYKYWYRQIKGEGPVLI 54


>ref|XP_003198184.1| PREDICTED: ig heavy chain V-I region HG3-like [Danio rerio]
          Length = 131

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 16/123 (13%)

Query: 89  QLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRAS--QSISDYLHWYQQKSHES 146
             L +++ +   S  +I + QSP +++  PG+ V +SC+ S     S Y+HW +QK  ++
Sbjct: 7   HFLCVVIVFQGISGDEIRLDQSP-SVTKRPGETVKISCKISGFTMTSSYMHWIRQKPGKA 65

Query: 147 PRLLIKYASQXXXXXXXXXXXXXXXXDFTLS-----------INSVEPEDVGVYYCQN-- 193
              + +  S                  FT+S             S+  ED  VYYC    
Sbjct: 66  LEWIGRVDSGSSSSSDYLIYADSVKNHFTMSEDVSQSTQFLEAKSLREEDTAVYYCARAP 125

Query: 194 GHS 196
           GHS
Sbjct: 126 GHS 128


>ref|XP_003197959.1| PREDICTED: hypothetical protein LOC100535098 [Danio rerio]
          Length = 199

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 52/121 (42%), Gaps = 14/121 (11%)

Query: 101 SRCDI--VMTQSPATLSVTPGDRVSLSCR-ASQSISDYLHWYQQKSHESPR-LLIKYASQ 156
           SRCD    + Q   T S   GD V+  C   + S    L WYQQK    P+ +L K+++ 
Sbjct: 83  SRCDSQDKVDQHTKTQSAFEGDTVTTDCTYQTSSTGPTLFWYQQKVSGVPKHMLNKFSTT 142

Query: 157 XXXXXXXXXXXXXXXXDFT---LSINSVEPEDVGVYYCQNGHSFPPTMMQ---TIAKTSR 210
                             T   L+I ++  +D  VYYC    +  PT+ Q   T+ KT R
Sbjct: 143 GNSEEELKKKRFHATLSKTSVPLTIQNLRVQDSAVYYC----ALKPTVTQTHSTLTKTPR 198

Query: 211 K 211
           +
Sbjct: 199 Q 199


>ref|XP_003197951.1| PREDICTED: ig kappa chain V-III region VH-like [Danio rerio]
          Length = 124

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 44/109 (40%), Gaps = 13/109 (11%)

Query: 93  LLLFWTSASRCDIVMTQSPATLSVTPGDR--VSLSCRASQSI-SDYLHWYQQKSHESPRL 149
           L+LF TSA+     + + P    V   +R  V+LSC  + S  SDYLHWY+Q     P  
Sbjct: 6   LILFCTSAAAVFGNVIK-PINTDVFTEERSNVTLSCSFTASGGSDYLHWYRQYGGSKPEF 64

Query: 150 LI-------KYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           L+       K A                  D  LS  S    D  VYYC
Sbjct: 65  LVLIYGSATKAAQSDIDTRFTANITKKEHVDLLLS--SAAVSDSAVYYC 111


>ref|XP_003197960.1| PREDICTED: hypothetical protein LOC100535742 [Danio rerio]
          Length = 113

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 89  QLLGLLLFWTSASRC-DIVMTQSPATLSVTPGDRVSLSCRASQSI-SDYLHWYQQKSHES 146
           +L  L+LF TSA+     V+      +    G  V+LSC  + S  +DYLHWY+Q     
Sbjct: 2   KLHSLILFCTSAAAVFGNVIRPINTDVFAEEGSNVTLSCSFTASGGTDYLHWYRQYGGSK 61

Query: 147 PRLLI 151
           P  L+
Sbjct: 62  PEFLV 66


>ref|XP_003197945.1| PREDICTED: ig lambda chain V-II region BO-like [Danio rerio]
          Length = 111

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 119 GDRVSLSCRASQSISD-YLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFT-- 175
           G+ V+LSC    + +D +L+WY+Q S+  P  ++   ++                D T  
Sbjct: 30  GESVTLSCTYETNSNDIWLYWYRQFSNREPEYILFKGARSRSEEDLPDGFQSRTSDSTTE 89

Query: 176 LSINSVEPEDVGVYYC 191
           ++INSV   D  +YYC
Sbjct: 90  ITINSVRLSDSALYYC 105


>ref|NP_001005768.1| novel immune-type receptor 5 precursor [Danio rerio]
          Length = 338

 Score = 35.4 bits (80), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 37/96 (38%), Gaps = 6/96 (6%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLL---IKYASQXXXXXXX 163
           +TQ    +S   G+ V L C  + S      WY+Q + E PRL+   I  +S+       
Sbjct: 23  ITQPDTVVSFQEGETVVLRCFITNSQMSMTLWYKQVTGEEPRLIASSILRSSEIQFHNEF 82

Query: 164 XXXXXXXXXD---FTLSINSVEPEDVGVYYCQNGHS 196
                    D   F L I +    D G YYC    S
Sbjct: 83  DSSHFEVLRDTGGFNLKIVNAVQSDSGTYYCATSFS 118


>ref|XP_003197957.1| PREDICTED: immunoglobulin omega chain-like [Danio rerio]
          Length = 157

 Score = 35.4 bits (80), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 46/107 (42%), Gaps = 12/107 (11%)

Query: 97  WTSASRCDIV----------MTQSPATLSVTPGDRVSLSCRASQSISDY-LHWYQQKSHE 145
           W   S C IV          + Q    ++ + GD+V +SC  S + +   L WY++  + 
Sbjct: 4   WAFISLCFIVHYDVCRGQDRVEQPIREMTESIGDKVVISCIYSTTYTSLTLFWYKKLPNR 63

Query: 146 SPRLLI-KYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           SP  ++ +Y+++                 F L+I ++   D  VYYC
Sbjct: 64  SPTYILNQYSTEADFKERFSATLDSTEKSFPLTIKNLHVSDSAVYYC 110


>ref|XP_002666277.1| PREDICTED: hypothetical protein LOC100331885 [Danio rerio]
          Length = 213

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 14/107 (13%)

Query: 89  QLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPR 148
           QL   LL WT          +S     V  G+ V+L C+        ++W  QK  +SP 
Sbjct: 5   QLSLYLLLWTQT-------VESLIDKRVKLGENVTLDCQIG---VKEMYWVFQKLIDSPV 54

Query: 149 LLIK-YASQXXXXXXXXXXXXXXXXDFTLS---INSVEPEDVGVYYC 191
           L+++ Y+S+                  TLS   I+S+  +++G+YYC
Sbjct: 55  LILRTYSSESTASFIPEDRLRDKYSSLTLSRLFISSITIDELGIYYC 101


>ref|NP_001018511.1| ganglioside-induced differentiation-associated protein 1 [Danio
           rerio]
          Length = 362

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 3   SLPASELSLPYHQDFRPDSSCPGLT-DNHLLCEPTQKPRY 41
           SLP SE + P+     P    P L  DNH++C+PTQ   Y
Sbjct: 71  SLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDPTQIMDY 110


>ref|NP_954581.3| novel immune-type receptor 6a precursor [Danio rerio]
          Length = 249

 Score = 34.7 bits (78), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 119 GDRVSLSCRASQ-SISDYLHWYQQKSHESPRLL-IKYASQXXXXXXXXXXXXXXXX---- 172
           GD V + C +++ S+ + L WY+QK+ + PR + I Y                       
Sbjct: 31  GDDVIIKCFSTKISLGNTLVWYKQKTGQIPRAITISYIQLNKVIFEDEFKDGRFSILPSE 90

Query: 173 -DFTLSINSVEPEDVGVYYC 191
             F L+I +   +D G+YYC
Sbjct: 91  DSFHLNITAATKQDTGIYYC 110


>ref|XP_003198968.1| PREDICTED: hypothetical protein LOC100538107 [Danio rerio]
          Length = 239

 Score = 33.9 bits (76), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 119 GDRVSLSCRAS-QSISDYLHWYQQKSHESPRLL-IKYASQXXXXXXXXX-----XXXXXX 171
           GD V + C ++ +S+ + L WY+Q + + PR + I Y  +                    
Sbjct: 31  GDDVIIKCFSTRKSVGNTLVWYKQSTGQIPRAITISYNHKGDVIFEDEFKDGRFSILSSE 90

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             F L+I +   +D G+YYC
Sbjct: 91  DSFHLNITAATKQDTGIYYC 110


>ref|XP_003197944.1| PREDICTED: ig kappa chain V-VI region NQ2-6.1-like [Danio rerio]
          Length = 140

 Score = 33.9 bits (76), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 93  LLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLI 151
           +LL     +R    +T     +  +  +RV LSC  + S+ D LHWY+Q     P  LI
Sbjct: 7   ILLILIEGNRAKDAITPYRDAVFASESERVKLSCNYTGSV-DSLHWYRQYPGSRPHFLI 64


>ref|NP_001121856.1| novel immune-type receptor 13 isoform 1 precursor [Danio rerio]
          Length = 350

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 10/95 (10%)

Query: 102 RCDIVMTQSPATLSVTPGDRVSLSC-----RASQSISDYLHWYQQKSHESPRLLIKYASQ 156
           +  + + Q P++ SV  G  ++L C     R+++ I   + W++  S + P   I Y + 
Sbjct: 138 KSKVSVVQHPSSHSVRSGVALTLICSVLSERSTEDIK--MFWFRSDSGDKPVPEILYTNN 195

Query: 157 XXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
                            F LSIN+V   D G YYC
Sbjct: 196 QSLQCESDFTHSCT---FNLSINTVSQMDTGTYYC 227



 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 93  LLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESP 147
           +LL     +  +IV    P  ++ + G+ V+L C   Q  SD + WY+Q +   P
Sbjct: 9   MLLCRIKRTESEIVQQPDPVMMA-SVGENVTLRCIILQEHSDPITWYKQTAGHQP 62


>ref|NP_001232002.1| similar to novel immune-type receptor 5, allele 3 precursor [Danio
           rerio]
          Length = 338

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 36/96 (37%), Gaps = 6/96 (6%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLL---IKYASQXXXXXXX 163
           + Q    +S   G+ V L C  + S      WY+Q + E PRL+   I  +S+       
Sbjct: 23  IIQPDTVVSFQEGETVVLRCFITNSQMSMTLWYKQVTGEEPRLIASSILRSSEIQFHNEF 82

Query: 164 XXXXXXXXXD---FTLSINSVEPEDVGVYYCQNGHS 196
                    D   F L I +    D G YYC    S
Sbjct: 83  DSSHFEVLRDTGGFNLKIVNAVQSDSGTYYCTTSFS 118


>ref|XP_003201256.1| PREDICTED: basement membrane-specific heparan sulfate proteoglycan
            core protein [Danio rerio]
          Length = 3711

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 20/87 (22%)

Query: 106  VMTQSPATLSVTPGDRVSLSCRASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXX 164
            V  + P   SV  G  VS  C A   +  Y L W ++ + + P   + +           
Sbjct: 1957 VFIEEPKAQSVRVGSTVSFICTAKSKLPAYTLVWTRKGNGKLPNRAMDF----------- 2005

Query: 165  XXXXXXXXDFTLSINSVEPEDVGVYYC 191
                    +  L+I +V+PED G+Y C
Sbjct: 2006 --------NGILTIQNVQPEDAGIYVC 2024


>ref|NP_001020668.1| novel immune-type receptor 11b precursor [Danio rerio]
          Length = 224

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 48/118 (40%), Gaps = 19/118 (16%)

Query: 84  MVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKS 143
           ++ ++ L+GLL          +V +     +S  PG+ V++ C+ + +    +HW++Q  
Sbjct: 4   LLISALLMGLL---------SLVKSSQIVNISAQPGENVTIWCKHTSNTGKNIHWFKQTH 54

Query: 144 HESP-RLLIKYASQXXXXXXXXXXXXXXXXDFTLSINS---------VEPEDVGVYYC 191
              P  ++ K  S                  F +S+N+         VE  D  +Y+C
Sbjct: 55  GAVPLNIVYKMISYKFEELHLKYLNDFQPDRFVMSLNTENTSLSILNVEISDSALYFC 112


>ref|XP_001331043.4| PREDICTED: hypothetical protein LOC791658 [Danio rerio]
          Length = 323

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 18/120 (15%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSL-------SCRASQS 131
           +VS+ Q  G+     LL   +A+  D  + QS    +V PGD V+L       SC    S
Sbjct: 113 VVSSYQATGMGSGTRLLVRDTAADRDTTLHQSLID-TVDPGDSVNLQCSIFTESCEGDHS 171

Query: 132 ISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           I    +W++Q S +S  +L     +                 ++L  N++   D G+YYC
Sbjct: 172 I----YWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSCV-YSLHKNNISRSDSGIYYC 226


>ref|XP_003198238.1| PREDICTED: ig lambda chain V-III region LOI-like [Danio rerio]
          Length = 124

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 8/98 (8%)

Query: 106 VMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPR-LLIKYASQXX------ 158
           V+TQSP  ++V+ G    L C         + WY+Q     P+ +L  Y ++        
Sbjct: 20  VVTQSPV-ITVSKGQTAQLDCNLGTVTDSGVRWYKQTPAGVPQYVLYDYHTRSSPIYGSG 78

Query: 159 XXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
                         D++L I++V+  D  VYYC+   S
Sbjct: 79  FAAPKFTSTHSSTSDYSLIISNVDVSDSAVYYCKTWDS 116


>ref|XP_003198962.1| PREDICTED: hypothetical protein LOC100537152 [Danio rerio]
          Length = 326

 Score = 32.7 bits (73), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 14/117 (11%)

Query: 84  MVSTSQLLGLLLFWTSASRCDIVMTQSPATL------SVTPGDRVSLSCR--ASQSISDY 135
           ++S  Q +G+     S +R  +  T   +TL      +V PGD V+L C         D+
Sbjct: 112 VISAYQTIGM----GSGTRLLVGATDRNSTLHQSLIDAVDPGDAVNLQCSIFTESCAGDH 167

Query: 136 -LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
            ++W++Q S +S  +L     +                 ++L  N++   D G+YYC
Sbjct: 168 SIYWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSCV-YSLHKNNISRSDSGIYYC 223


>ref|XP_002666721.1| PREDICTED: hypothetical protein LOC100332522 [Danio rerio]
          Length = 196

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 31/78 (39%), Gaps = 3/78 (3%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSI 178
           GDR+ LSC  S S       +++ S E  R++  Y                   DF+LSI
Sbjct: 25  GDRIELSCLQSSSKHKGNALWKKSSGE--RVIWNYYGDSNKGGSFTNRTVKLNDDFSLSI 82

Query: 179 NSVEPEDVGVYY-CQNGH 195
                 D G+Y  C NG 
Sbjct: 83  EGCAQSDQGIYILCINGE 100


>ref|XP_003198969.1| PREDICTED: hypothetical protein LOC100538145 [Danio rerio]
          Length = 240

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 7/80 (8%)

Query: 119 GDRVSLSCRASQ-SISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXX------XX 171
           GD V + C  ++ S+ + L WY+Q + + PR++    +Q                     
Sbjct: 31  GDDVIIKCFLTKMSLGNTLVWYKQSTGQIPRVITISYNQLNKVRFVDEFKDGRFSVLPSE 90

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             F L I +   +D G+YYC
Sbjct: 91  DSFHLKITAATKQDTGIYYC 110


>ref|NP_001020672.1| novel immune-type receptor 11a precursor [Danio rerio]
          Length = 195

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 82  LKMVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQ 141
           +++V ++ L+GLL           V +     ++  P + V++ C+ +  +  Y+HW++Q
Sbjct: 2   VRVVISALLMGLL---------SSVKSSQTGNITAQPVENVTIWCKHNAGVGQYIHWFKQ 52

Query: 142 KSHESP 147
                P
Sbjct: 53  THGAVP 58


>ref|NP_938160.1| immune-type receptor 1o [Danio rerio]
          Length = 358

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 10/116 (8%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCR--ASQSISDY- 135
           +VS+ Q +G+     L+   +A+  +  + QS    +V PGD V+L C         D+ 
Sbjct: 146 IVSSYQAIGMGSGTRLIVRDAATDRNTTLHQSLID-TVDPGDSVNLQCSIFTESCAGDHN 204

Query: 136 LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++W++Q S +S  +L     +                 ++L  N++   D G+YYC
Sbjct: 205 IYWFKQSSGDSEGVLYTKGERNGRCKNSAESETQSCV-YSLHKNNISRSDTGIYYC 259


>ref|XP_003198963.1| PREDICTED: hypothetical protein LOC100537250 [Danio rerio]
          Length = 239

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 7/80 (8%)

Query: 119 GDRVSLSCRAS-QSISDYLHWYQQKSHESPRLL-IKYASQXXXXXXXXXXXXXXXX---- 172
           GD V + C ++ + + + L WY+Q + + PR + I Y  +                    
Sbjct: 31  GDDVIIKCFSTRKGVGNTLVWYKQSTGQIPRAITISYNHKSEVIFDDEFKDGRFSILPSE 90

Query: 173 -DFTLSINSVEPEDVGVYYC 191
             F L+I +   +D G+YYC
Sbjct: 91  DSFHLNITAATKQDTGIYYC 110


>ref|XP_003197958.1| PREDICTED: ig lambda chain V-VI region AR-like [Danio rerio]
          Length = 159

 Score = 32.0 bits (71), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 36/88 (40%), Gaps = 11/88 (12%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXD----- 173
           G+  SLSC+   S+++ LHWY+Q     P  L  Y  +                D     
Sbjct: 34  GETASLSCKYEGSVTN-LHWYRQYPGSRPEFL-AYIYEHGATSKPLPPRLLPKVDKNSKR 91

Query: 174 FTLSINSVEPEDVGVYYCQNGHSFPPTM 201
            +L I+  E  D  +YYC    +  PTM
Sbjct: 92  VSLEISEAEVTDSALYYC----ALTPTM 115


>ref|NP_001018173.1| novel immune-type receptor 1b precursor [Danio rerio]
          Length = 324

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 10/116 (8%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCR--ASQSISDY- 135
           ++S  Q +G+     LL   SA+  +  + QS    +V PGD V+L C         D+ 
Sbjct: 112 VISAYQTIGMGSGTRLLVGDSATDRNSTLHQSLID-TVDPGDSVNLQCSIFTESCAGDHS 170

Query: 136 LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++W++Q S   P  +I    +                 ++L  N++   D G+YYC
Sbjct: 171 VYWFKQSSGH-PEGVIYTKGERNGRCKNSTESQTQSCVYSLHKNNISHSDTGIYYC 225


>ref|NP_001135740.1| immune-type receptor 5-like precursor [Danio rerio]
          Length = 337

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 35/96 (36%), Gaps = 6/96 (6%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLL---IKYASQXXXXXXX 163
           + Q    +S   G+   L C  + S      WY+Q + E PRL+   I  +S+       
Sbjct: 23  IIQPDTVVSFQEGETAVLRCFITNSQMSMTLWYKQVTGEEPRLIASSILRSSEIQFHNEF 82

Query: 164 XXXXXXXXXD---FTLSINSVEPEDVGVYYCQNGHS 196
                    D   F L I +    D G YYC    S
Sbjct: 83  DSSHFEVLRDTGGFNLKIVNAVQSDSGTYYCATSFS 118


>ref|XP_003198961.1| PREDICTED: hypothetical protein LOC100537054 [Danio rerio]
          Length = 240

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 119 GDRVSLSCRASQ-SISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXX------XX 171
           GD V + C  ++ S+ + L WY+Q + + PR +    +Q                     
Sbjct: 31  GDDVIIKCFLTKMSLGNTLVWYKQSTGQIPRAITISYNQLNKVRFVDEFKDGRFSVLPSE 90

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             F L I +   +D G+YYC
Sbjct: 91  DSFHLKITAATKQDTGIYYC 110


>ref|XP_001333297.2| PREDICTED: hypothetical protein LOC794617 isoform 2 [Danio rerio]
          Length = 199

 Score = 31.6 bits (70), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 47/121 (38%), Gaps = 19/121 (15%)

Query: 84  MVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKS 143
           ++ ++ L+GLL          +V +     +S  PG   ++ C+ + +    +HW++Q  
Sbjct: 4   LLISAMLMGLL---------SLVKSSQIVNISAQPGKNFTIWCKHTSNTGKTIHWFKQTH 54

Query: 144 HESP-RLLIKYASQXXXXXXXXXXXXXXXXDFTLSIN---------SVEPEDVGVYYCQN 193
              P  ++ K  S                  F +S+N         +V+  D  +Y+C  
Sbjct: 55  GAVPVDIVYKMISYQLKEIYVNYLNGFQQDHFVMSLNKENTSLSILNVDISDSALYFCGW 114

Query: 194 G 194
           G
Sbjct: 115 G 115


>ref|XP_003197933.1| PREDICTED: hypothetical protein LOC100534730 [Danio rerio]
          Length = 123

 Score = 31.6 bits (70), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 6/105 (5%)

Query: 90  LLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRL 149
           LL   LF  +A + +++ + S   + V  G   +LSC+ + +I + L WY+Q     P  
Sbjct: 6   LLLFTLFKGNAGK-EVISSLSTEQI-VLAGKNATLSCKYNSNIRN-LQWYRQYPGSKPEN 62

Query: 150 LIKYA---SQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           +I +    +Q                   LSI   E +D  +YYC
Sbjct: 63  IIFHTESNNQSYSRLRLLAVAEKEIKRMNLSIFHTEMQDSALYYC 107


>ref|NP_001032660.1| novel immune-type receptor 1n precursor [Danio rerio]
          Length = 325

 Score = 31.6 bits (70), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCR--ASQSISDY- 135
           +VS+ Q +G+     L+   +A+  +  + QS    SV PGD V+L C         D+ 
Sbjct: 113 VVSSYQAIGMGSGTRLIVRDAATDRNTTLHQSSID-SVDPGDSVNLQCSIFTESCAGDHS 171

Query: 136 LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++W++Q S +S  +L     +                 ++   N++   D G+YYC
Sbjct: 172 VYWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSCV-YSFHKNNISRSDSGIYYC 226


>ref|XP_001921797.2| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC100150420
           [Danio rerio]
          Length = 366

 Score = 31.6 bits (70), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C         D+ ++W++Q S +S  +L     +               
Sbjct: 188 TVDPGDSVNLQCSIFTESCAGDHSIYWFKQSSGDSEGVLYTKGERNGRCKNSAESETQSC 247

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 248 V-YSLHKNNISRSDTGIYYC 266


>ref|XP_001333206.2| PREDICTED: hypothetical protein LOC794617 isoform 1 [Danio rerio]
          Length = 224

 Score = 31.2 bits (69), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 47/121 (38%), Gaps = 19/121 (15%)

Query: 84  MVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKS 143
           ++ ++ L+GLL          +V +     +S  PG   ++ C+ + +    +HW++Q  
Sbjct: 4   LLISAMLMGLL---------SLVKSSQIVNISAQPGKNFTIWCKHTSNTGKTIHWFKQTH 54

Query: 144 HESP-RLLIKYASQXXXXXXXXXXXXXXXXDFTLSIN---------SVEPEDVGVYYCQN 193
              P  ++ K  S                  F +S+N         +V+  D  +Y+C  
Sbjct: 55  GAVPVDIVYKMISYQLKEIYVNYLNGFQQDHFVMSLNKENTSLSILNVDISDSALYFCGW 114

Query: 194 G 194
           G
Sbjct: 115 G 115


>ref|XP_003197949.1| PREDICTED: immunoglobulin iota chain-like [Danio rerio]
          Length = 131

 Score = 31.2 bits (69), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 9/87 (10%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKY----ASQXXXXXXXXXXXXXXXXDF 174
           G+ V+LSC+  + + + LHWY+Q     P+ L       A+                   
Sbjct: 34  GETVTLSCKY-EGVVNNLHWYRQYPGFRPKFLAYIYEHGATSKPLPPRLLPKVDKNSKRV 92

Query: 175 TLSINSVEPEDVGVYYCQNGHSFPPTM 201
           +L I+  E  D  +YYC    +  PTM
Sbjct: 93  SLEISEAEVTDSALYYC----ALTPTM 115


>ref|NP_938161.1| novel immune-type receptor 1l precursor [Danio rerio]
          Length = 316

 Score = 31.2 bits (69), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C         D+ ++W++Q S +S  +L     +               
Sbjct: 143 TVDPGDSVNLQCSIFTESCAGDHSIYWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSC 202

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 203 V-YSLHKNNISRSDSGIYYC 221


>ref|NP_001186301.1| uncharacterized protein LOC100331689 precursor [Danio rerio]
          Length = 203

 Score = 31.2 bits (69), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 29/73 (39%), Gaps = 1/73 (1%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSI 178
           G  V + C  + S +  L WY+Q  + SP L++   S                  F L I
Sbjct: 36  GAHVFVQCNYTSS-NPTLFWYKQLPNRSPTLILSQYSAEADKKRFSATLNSKEKSFPLLI 94

Query: 179 NSVEPEDVGVYYC 191
             ++  D  VYYC
Sbjct: 95  QDLQVSDSAVYYC 107


>ref|NP_938155.1| novel immune-type receptor 1m precursor [Danio rerio]
          Length = 356

 Score = 31.2 bits (69), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           ++ PGD V+L C         D+ ++W++Q+S +S  +L     +               
Sbjct: 159 TIDPGDSVNLQCSIFTESCAGDHSVYWFKQRSGDSEGVLYTKGERNGRCKNSTESQTQSC 218

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 219 V-YSLHKNNISRSDSGIYYC 237


>ref|NP_938162.1| novel immune-type receptor 1k precursor [Danio rerio]
          Length = 328

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 10/116 (8%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCR--ASQSISDY- 135
           ++S  Q +G+     LL   SA+  +  + QS    +V PGD V+L C         D+ 
Sbjct: 112 VISAYQTIGMGSGTRLLVGDSAADRNTTLHQSLID-TVDPGDSVNLQCSIFTESCAGDHS 170

Query: 136 LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++W++Q S   P  ++    +                 ++L  N++   D G+YYC
Sbjct: 171 VYWFKQSSGH-PEGVLYTKGERNGRCKNSTESQTQSCVYSLHKNNISRSDSGIYYC 225


>ref|XP_003197946.1| PREDICTED: immunoglobulin omega chain-like [Danio rerio]
          Length = 136

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 12/99 (12%)

Query: 114 LSVTPGDRVSLSC--RASQSISDYLHWYQQKSHESPRLLI------KYASQXXXXXXXXX 165
           L+   G+ V L C  +   + + YL+WY+Q    SP  ++      K  ++         
Sbjct: 31  LTSAEGNEVILLCNYKLMSAANAYLYWYKQLPDTSPAFILSEFSIGKGKAEPEFKDRFSA 90

Query: 166 XXXXXXXDFTLSINSVEPEDVGVYYCQNGHSFPPTMMQT 204
                     L+I  V   D  VYYC    +  PT+ QT
Sbjct: 91  KLDSKLETVPLTIKDVRVSDSAVYYC----ALQPTVTQT 125


>ref|XP_002662802.1| PREDICTED: hypothetical protein LOC100330879 isoform 2 [Danio
           rerio]
          Length = 316

 Score = 30.8 bits (68), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 12/84 (14%)

Query: 115 SVTPGDRVSL-------SCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXX 167
           +V PGD V+L       SC    SI    +W++Q S +S  +L     +           
Sbjct: 143 TVDPGDSVNLQCSIFTESCEGDHSI----YWFKQSSGDSEGVLYTKGERNGRCKDSTESQ 198

Query: 168 XXXXXDFTLSINSVEPEDVGVYYC 191
                 ++L  N++   D G+YYC
Sbjct: 199 TQSCV-YSLHKNNISRSDSGIYYC 221


>ref|XP_002661242.2| PREDICTED: ig heavy chain V-III region HIL [Danio rerio]
          Length = 136

 Score = 30.8 bits (68), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 9/85 (10%)

Query: 116 VTPGDRVSLSCRASQSI--SDYLHWYQQKSHESPRLL--IKYASQXXXXXXXXXXXXXXX 171
           + PG+ +SLSCR S     S+ +HW +Q+  ++   +  + Y +Q               
Sbjct: 40  LKPGETLSLSCRGSGFTFGSNNMHWIRQQPGKALMWMGRVWYNAQGHDYANSFKGRIEIT 99

Query: 172 XD-----FTLSINSVEPEDVGVYYC 191
            D       L ++++  ED  VYYC
Sbjct: 100 RDNSKSMVYLKLSALTEEDSAVYYC 124


>ref|XP_002667279.1| PREDICTED: hypothetical protein LOC100330441 [Danio rerio]
          Length = 242

 Score = 30.8 bits (68), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 110 SPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHES-PRLLIKYASQXXXXXXXXXXXX 168
           +   + V PG+ V+L C  +     ++ W +  SHE+ P L I                 
Sbjct: 23  TEVNMRVKPGESVTLYCDCALPFGSHIVWMRNCSHENQPSLFIDPPKLFLETFPRFIFLL 82

Query: 169 XXXXD-FTLSINSVEPEDVGVYYC 191
               + + L I +V   D G+YYC
Sbjct: 83  NSSSNSYDLHIENVSVSDEGLYYC 106


>ref|XP_003197952.1| PREDICTED: immunoglobulin omega chain-like [Danio rerio]
          Length = 122

 Score = 30.8 bits (68), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 7/76 (9%)

Query: 122 VSLSCRASQSISDY--LHWYQQKSHESPRLLI-KYASQXXXXXXXXXXXXXXXXDFT--- 175
           V LSC  S SI +Y  L+WY+Q  H  P+ L+ +YA                   +T   
Sbjct: 37  VKLSCSYSASI-EYVVLYWYRQYKHGEPQYLLRRYARSYNDYEATSDDRFQSDSSYTSTE 95

Query: 176 LSINSVEPEDVGVYYC 191
           L+I      D  +YYC
Sbjct: 96  LTIKDARLSDSALYYC 111


>ref|NP_571547.1| vascular endothelial growth factor receptor kdr-like precursor
           [Danio rerio]
          Length = 1301

 Score = 30.8 bits (68), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 20/34 (58%)

Query: 115 SVTPGDRVSLSCRASQSISDYLHWYQQKSHESPR 148
           +   GD ++L+CR ++ + D L WY    ++ P+
Sbjct: 553 TAVAGDDITLTCRGTRYLYDRLTWYDPLGYKVPK 586



 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 46/110 (41%), Gaps = 21/110 (19%)

Query: 85  VSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKS- 143
           ++T++++ +    T   R    + Q+     V     ++L+C A    + ++ WY+ K+ 
Sbjct: 622 INTNKVVNVTSALTIDERQGPWLMQNLTNQDVNSSSTLTLACLAYGVPAPFITWYKDKTP 681

Query: 144 -HESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ 192
             E P + +K                    D TL I  V+ +D G+Y C+
Sbjct: 682 VTEGPGITLK-------------------DDGTLIIERVKKDDEGIYECR 712


>ref|XP_001920377.3| PREDICTED: b-cell receptor CD22-like [Danio rerio]
          Length = 480

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 58/166 (34%), Gaps = 29/166 (17%)

Query: 35  PTQKPRYPDLGRKRSGENRHRYRDVCISFIRRSFSALCHNPQKLRENLKMVSTSQLLGLL 94
           P Q   YPDL        R +Y        +     L H  +K         T+ + G +
Sbjct: 64  PKQGQEYPDLSEDPEYSQRLQYLG---DKQQNCHLRLSHVTKKDEHQYYFRFTTNVTGKM 120

Query: 95  LFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISD--YLHWYQQKSHESPRLLIK 152
              T   R  +   Q  +   VT GD V L+C++S  ++D     WY+     + ++  K
Sbjct: 121 WLGTPGVRLSVTDLQLESPERVTEGDSVRLTCKSSCKLTDTPTFIWYRNSVTLTGKIGNK 180

Query: 153 YASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ-NGHSF 197
                                  L +N V  ED G Y C  +GH+ 
Sbjct: 181 -----------------------LILNPVRREDAGRYSCGVDGHTL 203


>ref|NP_001011881.1| novel immune-type receptor 1j precursor [Danio rerio]
          Length = 323

 Score = 30.4 bits (67), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 84  MVSTSQLLGL-----LLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCR--ASQSISDY- 135
           ++STS  +G+     LL   +A+  +  + QS    +V PGD V+L C         D+ 
Sbjct: 110 VISTSYNIGMGSGTRLLVRDAAADKNTTLHQSLID-TVDPGDSVNLQCSIFTESCAGDHS 168

Query: 136 LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
           ++W++Q S +S  +L     +                 ++   N++   D G+YYC
Sbjct: 169 VYWFKQSSGDSEGVLYT-KGETNGHCNKSTKSQTQSCVYSFHKNNISRSDSGIYYC 223


>ref|NP_571721.1| novel immune-type receptor 1i [Danio rerio]
          Length = 335

 Score = 30.4 bits (67), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C         D+ ++W++Q S +S  L+     +               
Sbjct: 162 AVDPGDSVNLQCSIFTESCAGDHSIYWFKQISGDSVGLIYTKGERNGRCKNSTESQTQSC 221

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 222 V-YSLHKNNISRSDSGIYYC 240


>ref|XP_003197934.1| PREDICTED: hypothetical protein LOC100534813 [Danio rerio]
          Length = 146

 Score = 30.4 bits (67), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 30/79 (37%), Gaps = 4/79 (5%)

Query: 116 VTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYAS---QXXXXXXXXXXXXXXXX 172
           V  G   +LSC+ + ++   L WY+Q     P  +I +     Q                
Sbjct: 53  VLAGKNATLSCKYNGNVYS-LQWYRQYPGSKPENIIYHTESNKQSHSRLRLLAVTEKGMK 111

Query: 173 DFTLSINSVEPEDVGVYYC 191
              LSI   E ED  +YYC
Sbjct: 112 RMNLSIFHTEMEDSALYYC 130


>ref|XP_003197935.1| PREDICTED: ig heavy chain V-III region CAM-like [Danio rerio]
          Length = 176

 Score = 30.4 bits (67), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 12/93 (12%)

Query: 116 VTPGDRVSLSCRASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDF 174
           +T G  ++LSC  + +I+ Y LHWY+Q     P  L+                     + 
Sbjct: 16  LTEGSNITLSC--TFNITPYSLHWYRQMPGSRPEFLLLIVRSTKTKVAASPPQPHMSINL 73

Query: 175 T-----LSINSVEPEDVGVYYCQNG----HSFP 198
           +     L I+S    D  VYYC       H FP
Sbjct: 74  SEKRVDLEISSAAVSDSAVYYCALEPTLYHQFP 106


>ref|XP_003197820.1| PREDICTED: hypothetical protein LOC100537163 [Danio rerio]
          Length = 393

 Score = 30.4 bits (67), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 36/78 (46%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXD 173
           +S  PG  +S++C  ++ + + + +  + S+ S    I   S                 +
Sbjct: 137 VSGEPGKHLSITCSYTRDLKELIRFLCKGSNPSHCKNIIKVSSETKTNGRFSLTDDSERN 196

Query: 174 FTLSINSVEPEDVGVYYC 191
           FT++I+ +  ED G+Y+C
Sbjct: 197 FTVNISDLTEEDSGIYWC 214


>ref|XP_003201143.1| PREDICTED: hypothetical protein LOC100537953 [Danio rerio]
          Length = 192

 Score = 30.4 bits (67), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDF--TL 176
           G  VS++C   +   + ++W  QK+ E P ++++  S                  F   L
Sbjct: 26  GSNVSINCNLDE---NEVYWIIQKTPEPPTVILRSFSTPAASYFNKSFRSKYSVQFKHNL 82

Query: 177 SINSVEPEDVGVYYCQNGHSFPP 199
            I+++  +++G+YYC    + PP
Sbjct: 83  VIHNITTDELGIYYCMKTGT-PP 104


>ref|NP_938163.1| novel immune-type receptor 1d precursor [Danio rerio]
          Length = 324

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V L C         D+ ++W++Q S +S  +L     +               
Sbjct: 147 AVDPGDSVHLQCSIFTESCAGDHRVYWFKQSSGDSEGVLYTKGERNGRCKNSTESQTQSC 206

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 207 V-YSLHKNNISRSDSGIYYC 225


>ref|XP_003197947.1| PREDICTED: immunoglobulin omega chain-like [Danio rerio]
          Length = 126

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 13/95 (13%)

Query: 119 GDRVSLSCRASQSISD---YLHWYQQKSHESPRLLI-KYASQXXXXXXXXXXXXXXXXDF 174
           GD+++L C  + + ++   YL WY+Q    SP  ++ K+                   + 
Sbjct: 36  GDQITLMCNYTTTSTNADVYLFWYKQLPDRSPTFILNKFPFSEGTIEPEFNKRFSAKLNS 95

Query: 175 TLS-----INSVEPEDVGVYYCQNGHSFPPTMMQT 204
           TL      I  +   D  VYYC    +  PT+ QT
Sbjct: 96  TLRTVPLLIQDLRVSDSAVYYC----ALRPTLTQT 126


>ref|NP_938164.1| novel immune-type receptor 1c precursor [Danio rerio]
          Length = 328

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCRA---SQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C     S + +  ++W++Q S   P  +I    +               
Sbjct: 147 TVDPGDSVNLQCSIFTESCAKNHSVYWFKQSSGH-PEGVIYTKGERNDRCKNSTESQTQS 205

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 206 CVYSLHKNNISHSDSGIYYC 225


>ref|NP_938169.1| novel immune-type receptor 3d isoform 1 precursor [Danio rerio]
          Length = 223

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 9/81 (11%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYAS--------QXXXXXXXXXXXXXX 170
           G  V+L C  S      + WY+  + + P LLI +++        Q              
Sbjct: 35  GSSVTLPCFHSDDFITTISWYKHSAGKKP-LLIAHSAPNSGRVTYQNAFNNTNRFFITIA 93

Query: 171 XXDFTLSINSVEPEDVGVYYC 191
              + LSI  +E ED   YYC
Sbjct: 94  SGSYNLSIIHLEKEDFATYYC 114


>ref|NP_001120804.1| secreted immunoglobulin domain 1 precursor [Danio rerio]
          Length = 136

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 7/45 (15%)

Query: 113 TLSVTPGDRVSLSC----RASQSISDYLHWYQQKSHESPRLLIKY 153
           T+SV  G  V+LSC     +S+ +   L WY+Q + +  R+++ Y
Sbjct: 29  TISVQQGQNVTLSCPLMPNSSEGV---LSWYKQTAGQGLRIILSY 70


>ref|NP_001245248.1| diverse immunoglobulin domain-containing protein 1.1 precursor
           [Danio rerio]
          Length = 318

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 43/123 (34%), Gaps = 14/123 (11%)

Query: 84  MVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSI--SDYLHWYQQ 141
           M   S L  LL+FWT ++    V       +    G+ V L CR +     +    W   
Sbjct: 1   MADRSPLFLLLIFWTLSTG---VFGAGETRVFSRSGETVHLPCRNTDQHCRTSGTTWI-- 55

Query: 142 KSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ-----NGHS 196
             + SPRL                       D +L I+ V  ED G Y CQ      GH 
Sbjct: 56  --YSSPRLTAAVELIELGVKKTNSERLNLGSDCSLIISRVTTEDAGSYICQQWSGKGGHH 113

Query: 197 FPP 199
           + P
Sbjct: 114 YGP 116


>ref|XP_001923759.3| PREDICTED: hypothetical protein LOC100004978 [Danio rerio]
          Length = 243

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHES-PRLLI---KYASQXXXXXXXXXXXXX 169
           + V PG+ V+L C  +     ++ W +  SHE+ P L I   K   +             
Sbjct: 27  MRVKPGESVTLYCDCALPFGSHIVWMRNCSHENQPSLFIDPPKLFLETFPRFSFLLNSSS 86

Query: 170 XXXDFTLSINSVEPEDVGVYYC 191
              D  L I +V   D G+YYC
Sbjct: 87  NSYD--LHIENVSVSDEGLYYC 106


>ref|NP_938168.1| novel immune-type receptor 3d isoform 2 precursor [Danio rerio]
          Length = 223

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 9/81 (11%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYAS--------QXXXXXXXXXXXXXX 170
           G  V+L C  S      + WY+  + + P LLI +++        Q              
Sbjct: 35  GSSVTLPCFHSDDFITTISWYKHSAGKKP-LLIAHSAPNSGRVTYQNTFNNTNRFFITIA 93

Query: 171 XXDFTLSINSVEPEDVGVYYC 191
              + LSI  +E ED   YYC
Sbjct: 94  SGSYNLSILHLEKEDFATYYC 114


>ref|NP_001007212.1| novel immune-type receptor 3b [Danio rerio]
          Length = 230

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 9/81 (11%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYAS--------QXXXXXXXXXXXXXX 170
           G  V+L C  S      + WY+  + + P LLI +++        Q              
Sbjct: 35  GSSVTLPCFHSDDFITTISWYKHSAGKKP-LLIAHSAPNSGSVTYQYAFNNTNRFFITIA 93

Query: 171 XXDFTLSINSVEPEDVGVYYC 191
              + LSI  +E ED   YYC
Sbjct: 94  SGSYNLSILHLEKEDFANYYC 114


>ref|NP_991212.1| uncharacterized protein LOC402947 [Danio rerio]
          Length = 140

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSH 144
           + + P+ L V+ G+  +L+C+A    +  + WY+   H
Sbjct: 29  IVEDPSDLIVSKGEPATLNCKAEGRPAPTVQWYKDGEH 66


>ref|NP_571727.1| novel immune-type receptor 3a precursor [Danio rerio]
          Length = 337

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSI--SDY-LHWYQQKS-HESPRLLIKYASQXXX-XX 161
           + Q P +  + PGD V+L C  S  I    Y ++W++  S +  P ++  + ++      
Sbjct: 143 VIQQPVSDRLHPGDSVTLQCSVSSHICAGHYRVYWFKHSSGYSQPGIIYTHDNRSDQCLK 202

Query: 162 XXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
                       ++LS   +   D GVYYC
Sbjct: 203 SSEKSSFVQSCVYSLSQTELTTSDAGVYYC 232


>ref|NP_001007203.1| novel immune-type receptor precursor [Danio rerio]
          Length = 333

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 34/91 (37%), Gaps = 10/91 (10%)

Query: 109 QSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYAS--------QXXXX 160
           Q P  L+   G  V+L C  S      + WY+  + + P LLI Y+         +    
Sbjct: 26  QQPLVLA-ELGSSVTLPCFHSDDFVTTISWYKHSAGKKP-LLIAYSDFNSGRVTYRNAFN 83

Query: 161 XXXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
                        + L+I  +E ED   YYC
Sbjct: 84  NTNRFFITVASGSYNLTIIHLEKEDFATYYC 114



 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSI--SDY-LHWYQQKS-HESPRLLIKYASQXXX-XX 161
           + Q P +  + PGD V+L C  S  I    Y ++W++  S +  P ++  + ++      
Sbjct: 143 VIQQPVSDRLHPGDSVTLQCSVSSHICAGHYRVYWFKHSSGYSQPGIIYTHDNRSDQCLE 202

Query: 162 XXXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
                       ++LS   +   D GVYYC
Sbjct: 203 SSEKSSFVQSCVYSLSQTELTTSDAGVYYC 232


>ref|XP_001921605.2| PREDICTED: hypothetical protein LOC559375 [Danio rerio]
          Length = 814

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 33/88 (37%), Gaps = 20/88 (22%)

Query: 44  LGRKRSGENRHRYRDVCISFIRRSFSALCHNPQKLR-----ENLKMVSTSQLLGLLLFWT 98
           LG   S E        C S+++    A+C +  KL+     EN+   +            
Sbjct: 150 LGGTESPEKAANQTQNCASYVKDEMEAVCGDHDKLKCQDGEENIDFEAV----------- 198

Query: 99  SASRCDIVMTQSPATLSVTPGDRVSLSC 126
               CD+ +T +P +L +  G  +   C
Sbjct: 199 ----CDVNLTNTPPSLEILKGKEILKPC 222


>ref|XP_002663948.1| PREDICTED: hypothetical protein LOC100329481 [Danio rerio]
          Length = 315

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 50/129 (38%), Gaps = 18/129 (13%)

Query: 90  LLG---LLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISD--YLHWYQQKSH 144
           LLG   + L + SA    I++ Q P  + V  G  V + C  S        + W++ K+ 
Sbjct: 112 LLGFSVMALIYLSAEG-SIIVFQKPRFIGVKTGRTVIIYCVPSNPTRGPARVQWFKNKN- 169

Query: 145 ESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHSFPPTMMQT 204
                   Y S                 + ++++  VE ED G Y C+   +F P    T
Sbjct: 170 --------YQSSLTNDQRITINDRNNDKNASITLKKVETEDSGTYVCKLNDTFGP---GT 218

Query: 205 IAKTSRKAE 213
             + SR +E
Sbjct: 219 ALQVSRYSE 227


>ref|NP_001153138.1| immunoglobulin superfamily member 3 precursor [Danio rerio]
          Length = 1042

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 42/105 (40%), Gaps = 17/105 (16%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSISDYLH----WYQQKSHE---SPRLLIKYASQX 157
           + +T +  TL+   GD + LSC  ++  S + H    W+ + + +    PR L+  +   
Sbjct: 146 LAVTAAAQTLAKVEGDTLQLSCEVTRQTSQHTHVSVGWFLRPTDDPSSGPRDLVTLSRDF 205

Query: 158 XXXXXXXXXXXXXXXD----------FTLSINSVEPEDVGVYYCQ 192
                          D          + L+I  ++P D G +YC+
Sbjct: 206 VLRPGGQYRQRLSSGDLRLDKTSATSYRLTIYKLQPSDQGEFYCE 250


>ref|XP_003197821.1| PREDICTED: polymeric immunoglobulin receptor-like [Danio rerio]
          Length = 423

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESP-RLLIKYASQXXXXXXXXXXXXXXXX 172
           +S  PG  ++++C  ++ + + + +  + S  S  + +IK +S+                
Sbjct: 131 VSGEPGKHLNITCSYTRDLKELIRFLCKGSDPSDCKKMIKVSSETNTTGRFSLTDDSER- 189

Query: 173 DFTLSINSVEPEDVGVYYC 191
           +FT++I  +  ED G+Y+C
Sbjct: 190 NFTVNIRDLTEEDSGIYWC 208


>ref|NP_694508.1| mucosa associated lymphoid tissue lymphoma translocation gene 1
           [Danio rerio]
          Length = 806

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 78  LRENLKMVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLH 137
           L + LK +   + +G L       + DI+  Q P +  +  G  V LSC+A   +     
Sbjct: 82  LLQCLKKIEHREAVGFLTM-NVMEQIDII--QQPQSQRIAEGSPVVLSCKAVGPVELQYQ 138

Query: 138 WYQQKSH----ESPRLLIKYAS 155
           W++ K       SP L+   AS
Sbjct: 139 WFKGKDEMPEGNSPDLVFNRAS 160


>ref|NP_001245161.1| diverse immunoglobulin domain-containing protein 1.3-4 precursor
           [Danio rerio]
          Length = 286

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 12/114 (10%)

Query: 84  MVSTSQLLGLLLFWTSASRC----DI-VMTQSPATLSVTPGDRVSLSCRASQSISDYLHW 138
           M   S L  LL+FWT ++      DI V ++S  T+ + P +     CR S++   Y  +
Sbjct: 1   MADRSPLFLLLIFWTLSTGVFGVEDIDVFSRSGETVHL-PCNNTVQHCRPSETTWTYGRY 59

Query: 139 YQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ 192
            Q  + E    LI +  +                D +L I+ V  ED G+Y CQ
Sbjct: 60  RQTTADE----LICFGRKKAKPEKHERLNLGS--DCSLIISRVTTEDAGLYICQ 107


>ref|NP_001018172.1| novel immune-type receptor 2a precursor [Danio rerio]
          Length = 328

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 30/82 (36%), Gaps = 6/82 (7%)

Query: 116 VTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLI------KYASQXXXXXXXXXXXXX 169
           V  GD V+ +C     I + + W +Q   ++P  ++       +  +             
Sbjct: 28  VQAGDTVNFTCSLLNEIRNSVVWIKQSVGKNPLTVVSSFQNVDHKFENDFDKHNRFFVTK 87

Query: 170 XXXDFTLSINSVEPEDVGVYYC 191
               F LSI + E  D   YYC
Sbjct: 88  DDVSFNLSITNTEVSDSATYYC 109


>ref|NP_001005578.1| novel immune-type receptor 7b precursor [Danio rerio]
          Length = 243

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 9/96 (9%)

Query: 105 IVMTQSPATL-SVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLI-KYA------SQ 156
           I+  +  A + +V  G  VSL C      S YL W++Q     P  ++ +Y       S 
Sbjct: 16  IIFVKHAAFMETVYSGTNVSLLCSNILKESSYLAWFKQTDDSLPLCIVTQYVGLNPADST 75

Query: 157 XXXXXXXXXXXXXXXXDF-TLSINSVEPEDVGVYYC 191
                            F TL I SV+  D G +YC
Sbjct: 76  YLNGFQKTRIEMSVNATFSTLRIISVDVSDSGTFYC 111


>ref|XP_001342685.4| PREDICTED: hypothetical protein LOC100003040 [Danio rerio]
          Length = 416

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 93  LLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSIS-DYLHWY 139
           +LLF  S +    V T+    LSVT GD ++L    SQ  S D + W+
Sbjct: 7   ILLFVLSINAVIRVETEDVECLSVTVGDSLTLQTNVSQIESNDAIEWW 54


>ref|XP_003201336.1| PREDICTED: hypothetical protein LOC100537913 [Danio rerio]
          Length = 720

 Score = 28.5 bits (62), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 217 NFSLRLKSVRTEDKGVYMCQ 236


>ref|NP_001007220.1| novel immune-type receptor 1a precursor [Danio rerio]
          Length = 329

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C         D+ ++W++Q S   P  ++    +               
Sbjct: 147 TVDPGDAVNLQCSIFTESCAGDHSVYWFKQSSGH-PEGVLYTKGERNGRCKKTTESQTQS 205

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N++   D G+YYC
Sbjct: 206 CVYSLHKNNISRSDSGIYYC 225


>ref|XP_003200226.1| PREDICTED: hypothetical protein LOC100006926 [Danio rerio]
          Length = 578

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 30/84 (35%), Gaps = 6/84 (7%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSI 178
           G+ V L C  + S      W   +  E+  L+   A                  D +L+I
Sbjct: 320 GENVHLPCNNAHSGCTSTTWNYNRHSETVELV---AGGSLKTNIKRRERLSLGSDCSLNI 376

Query: 179 NSVEPEDVGVYYCQ---NGHSFPP 199
             V  ED G Y CQ   NG  + P
Sbjct: 377 KKVTKEDYGSYICQQYVNGEQYGP 400


>ref|NP_001005576.1| novel immune-type receptor 9 precursor [Danio rerio]
          Length = 285

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 93  LLLFWTSASRCDIVMTQSPAT---LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRL 149
           ++ FW     C I ++ +      + V  G+ V++SC     ++ +  WY+ K  ++P L
Sbjct: 1   MINFWIFGLFCLIGISSTHPNAPPVFVKLGESVNMSCIYQSQMARHFSWYKHKPGQNPML 60

Query: 150 L 150
           +
Sbjct: 61  I 61


>ref|XP_003197826.1| PREDICTED: CMRF35-like molecule 9-like [Danio rerio]
          Length = 423

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESP-RLLIKYASQXXXXXXXXXXXXXXXX 172
           +S  PG  +S++C  ++ + + + +  + S  S  + +IK +S+                
Sbjct: 131 VSGEPGKHLSITCSYTRDLKELIRFLCKGSDPSDCKNIIKVSSKTKTNGRFSLTDDSETV 190

Query: 173 DFTLSINSVEPEDVGVYYC 191
            FT++I  +  ED G+Y+C
Sbjct: 191 -FTVNIRDLTEEDSGIYWC 208


>ref|XP_001923800.1| PREDICTED: titin [Danio rerio]
          Length = 32757

 Score = 28.1 bits (61), Expect = 4.4,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 109  QSPATLSVTPGDRVSLSCRASQSISDYLHWYQ 140
            + P  +SVT GD  +L C+ S S    + W++
Sbjct: 5181 EKPPCISVTAGDSATLECKVSGSPDLKVKWFK 5212


>ref|NP_001073429.2| matrix-remodelling associated 8b precursor [Danio rerio]
          Length = 434

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 18/25 (72%)

Query: 173 DFTLSINSVEPEDVGVYYCQNGHSF 197
           DF+LS+++++P D G++ C   H +
Sbjct: 246 DFSLSLHNIQPADKGLFSCHLHHHY 270



 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 173 DFTLSINSVEPEDVGVYYCQNGHSFPPT-----MMQTIAKTSRKAE 213
           +F+L IN+V+  D G+Y C   H +        M   I K+ RK +
Sbjct: 110 NFSLVINNVDMNDKGIYTCNLHHHYCKVHQSVQMQLNITKSPRKEK 155


>ref|XP_003200434.1| PREDICTED: hypothetical protein LOC100534684 [Danio rerio]
          Length = 302

 Score = 28.1 bits (61), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 136 LHWYQQKSHESPRLLI--KYASQXXXXXXXXXXXXXXXXDFT---LSINSVEPEDVGVYY 190
           ++WY+Q+  E+ RL++     S+                D T   L++ ++EPED  +Y+
Sbjct: 1   MYWYRQRPGETMRLIVFTMENSKPDFGDFDEKKYDASKEDPTSGSLTVKNLEPEDSAIYF 60

Query: 191 C 191
           C
Sbjct: 61  C 61


>ref|NP_956958.1| cell adhesion molecule 2a precursor [Danio rerio]
          Length = 405

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXD 173
           ++VT G   +L+CR   + +  L W    S+ + + L  +  +                +
Sbjct: 47  MTVTEGGTANLTCRVEHNDNTSLQW----SNPAQQTLF-FGDKKALRDNRIELVRATSQE 101

Query: 174 FTLSINSVEPEDVGVYYC 191
            T+SI+ V   D G+Y C
Sbjct: 102 LTISISEVSLSDEGLYTC 119


>ref|XP_003197943.1| PREDICTED: immunoglobulin omega chain-like [Danio rerio]
          Length = 125

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 31/79 (39%), Gaps = 7/79 (8%)

Query: 119 GDRVSLSCRASQSISDYLHWYQQKSHESPR-LLIKYASQXXXXXX-----XXXXXXXXXX 172
            + VSLSC+     ++ L WY+Q    +P  LL+ Y S                      
Sbjct: 34  SETVSLSCKYDTQANN-LQWYRQYPGSTPEYLLLVYESNTVFHAEPPFPRLDASVNKVEK 92

Query: 173 DFTLSINSVEPEDVGVYYC 191
              L+I+S    D  VYYC
Sbjct: 93  QVNLTISSAAVTDSAVYYC 111


>ref|XP_002662355.1| PREDICTED: myosin light chain kinase, smooth muscle [Danio rerio]
          Length = 1002

 Score = 27.7 bits (60), Expect = 6.5,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 35/92 (38%), Gaps = 16/92 (17%)

Query: 106 VMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXX 165
           V  Q  + ++V  G+R+ L C+ +  +   + W        P   I  + +         
Sbjct: 167 VFKQPLSDITVVDGERLRLECQVTSDLQAAITWILDGKTVKPSKFIVLSHEGEKC----- 221

Query: 166 XXXXXXXDFTLSINSVEPEDVGVYYC--QNGH 195
                    +L+I+   PED G Y C  +N H
Sbjct: 222 ---------SLTIDKALPEDEGRYTCRAENAH 244


>ref|NP_001018542.1| uncharacterized protein LOC553735 [Danio rerio]
          Length = 325

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 226 NFSLKLKSVRTEDKGVYMCQ 245


>ref|NP_571730.1| novel immune-type receptor 4a isoform 2 precursor [Danio rerio]
          Length = 337

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 37/89 (41%), Gaps = 6/89 (6%)

Query: 107 MTQSPATLSVTPGDRVSLSCRASQSISDY----LHWYQQKSHESPRLLIKYASQXXXXXX 162
           + Q P    + PG  V+L C   +   D     ++W++Q S+ + + ++    +      
Sbjct: 142 VIQLPVHAVINPGSNVTLRCSVERKTCDKDVQSVYWFRQSSNTTHQGIVYTHGKSKNECA 201

Query: 163 XXXXXXXXXXDFTLSINSVEPEDVGVYYC 191
                     +  L+  SV+  + G+YYC
Sbjct: 202 DSSDTQSCLQN--LAKMSVDVSEAGLYYC 228


>ref|NP_001007293.1| novel immune-type receptor 1f precursor [Danio rerio]
          Length = 327

 Score = 27.7 bits (60), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 33/80 (41%), Gaps = 4/80 (5%)

Query: 115 SVTPGDRVSLSCR--ASQSISDY-LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXX 171
           +V PGD V+L C         D+ ++W++Q   +S  +L     +               
Sbjct: 146 TVDPGDSVNLQCSIFTESCAGDHSVYWFKQSLGDSEGVLYTKGERNGRCKNSTESQTQSC 205

Query: 172 XDFTLSINSVEPEDVGVYYC 191
             ++L  N+    D G+YYC
Sbjct: 206 V-YSLHKNNFSGSDSGIYYC 224


>ref|XP_684938.3| PREDICTED: butyrophilin subfamily 2 member A2-like [Danio rerio]
          Length = 316

 Score = 27.7 bits (60), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 226 NFSLRLKSVRTEDKGVYMCQ 245


>ref|NP_001120726.1| novel immune-type receptor 13 isoform 2 precursor [Danio rerio]
          Length = 136

 Score = 27.3 bits (59), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 104 DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESP 147
           +IV    P  ++ + G+ V+L C   Q  SD + WY+Q +   P
Sbjct: 20  EIVQQPDPVMMA-SVGENVTLRCIILQEHSDPITWYKQTAGHQP 62


>ref|XP_001341831.3| PREDICTED: hypothetical protein LOC100001930 [Danio rerio]
          Length = 417

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 173 DFTLSINSVEPEDVGVYYCQN 193
           +F+L + SV  ED GVY CQ 
Sbjct: 199 NFSLRLKSVRTEDKGVYMCQG 219


>ref|XP_003199104.1| PREDICTED: leucine-rich repeat neuronal protein 1 [Danio rerio]
          Length = 744

 Score = 27.3 bits (59), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 50/125 (40%), Gaps = 14/125 (11%)

Query: 71  LCHNPQKL-RENLKMVSTSQLLGLLLFWTSASR-CDIVMTQS--PATLSVTPGDRVSLSC 126
           LC +PQ L  + L+ V ++        W  AS  C  +++Q   P  L+VT G  ++L C
Sbjct: 397 LCASPQHLVGQALQDVVSAS-------WNGASNTCLPLISQHAFPPQLNVTLGQLLTLDC 449

Query: 127 RASQSISDYLHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDV 186
            A    +   +W    +    ++  +  S                    L I  +EPED 
Sbjct: 450 WAVADPAPQFYWV---TPTGDKVTSEAVSPSSNEGGGTPKKHRMQDQGALEIPHIEPEDT 506

Query: 187 GVYYC 191
           G+Y C
Sbjct: 507 GLYTC 511


>ref|XP_001922166.2| PREDICTED: e3 ubiquitin-protein ligase TRIM21 [Danio rerio]
          Length = 372

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/90 (20%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 112 ATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIK-YASQXXXXXXXXXXXXXX 170
           A L    G  V+++C   +   + ++W  QK+ + P ++++ +++               
Sbjct: 19  ADLLTALGSNVTINCDLDE---NDVYWILQKTPDPPTVILRSFSTPASSLYLNKSFRIKY 75

Query: 171 XXDFT--LSINSVEPEDVGVYYCQNGHSFP 198
              F   L IN++  +++G+YYC +  + P
Sbjct: 76  SVQFKHRLVINNLTADELGLYYCMSTRTPP 105


>ref|XP_003197961.1| PREDICTED: CMRF35-like molecule 5-like [Danio rerio]
          Length = 246

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 35/87 (40%), Gaps = 11/87 (12%)

Query: 122 VSLSCRASQSISDY--LHWYQQKSHESPRLLIKYASQXXXXXXXXXXXXXXXXDFT---- 175
           ++L C    S + Y  L WYQQ ++ SP+ ++   S                 + +    
Sbjct: 39  ITLECTYKASSTQYPNLLWYQQMTNGSPKYMLMRLSGSSDTNEEFKQRFNAELNTSALSI 98

Query: 176 -LSINSVEPEDVGVYYCQNGHSFPPTM 201
            L+I  +   D  VYYC    +  PT+
Sbjct: 99  PLTIKDLRASDSAVYYC----ALKPTI 121


>ref|XP_002667765.2| PREDICTED: butyrophilin-like protein 2-like [Danio rerio]
          Length = 508

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 467 NFSLRLKSVRTEDKGVYMCQ 486


>ref|XP_003199219.1| PREDICTED: myosin light chain kinase, smooth muscle-like [Danio
           rerio]
          Length = 722

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 37/94 (39%), Gaps = 14/94 (14%)

Query: 99  SASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQXX 158
           +A + + V  +  + ++V  G+R+ L C+ S      + W        P   I   ++  
Sbjct: 593 AAGKKEPVFVEKLSDVTVLDGERLHLQCQLSSESPAKVTWMLDGKVIRPSKFIIITNEGD 652

Query: 159 XXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ 192
                          ++LSI+   PED G Y C+
Sbjct: 653 R--------------YSLSIDKALPEDEGQYVCR 672


>ref|NP_001018583.1| leucine rich repeat containing 4C precursor [Danio rerio]
          Length = 647

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 38/95 (40%), Gaps = 23/95 (24%)

Query: 106 VMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQK----SHESPRLLIKYASQXXXXX 161
           V+ + PA L+VT G    L CRA+   S  + W        +H + ++ I   +      
Sbjct: 356 VIVEPPADLNVTEGMAAELKCRANSLTS--VSWITPNGSIMTHGAYKIRISVLN------ 407

Query: 162 XXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
                      D TL+  +V  +D G Y C   +S
Sbjct: 408 -----------DGTLNFTNVTMQDTGTYTCMVSNS 431


>ref|XP_003197822.1| PREDICTED: polymeric immunoglobulin receptor-like [Danio rerio]
          Length = 391

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 114 LSVTPGDRVSLSCRASQSISDYLHWYQQKSHESP-RLLIKYASQXXXXXXXXXXXXXXXX 172
           +S  PG  +S++C  ++ + +++ +  + S  S  + +IK +S+                
Sbjct: 137 VSGEPGKHLSITCSYTRDLKEHIRFLCKGSDPSDCKNMIKVSSETKTNGRFSLTDDSERV 196

Query: 173 DFTLSINSVEPEDVGVYYC 191
            FT++I  +   D G+Y+C
Sbjct: 197 -FTVNIRDLAEGDSGIYWC 214


>ref|XP_003201334.1| PREDICTED: butyrophilin subfamily 2 member A2-like [Danio rerio]
          Length = 261

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 42/100 (42%), Gaps = 12/100 (12%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSIS-DYLH---WYQ-QKSHESPRLLIKYASQXXX 159
           ++++ S  ++S   G+ V+L+C     I+ +Y+    W +  K  + P LL +       
Sbjct: 141 LLVSGSDESISAYAGEDVTLNCSVDSHITPEYIEEVSWKKTDKDGDFPVLLYQNNETVSE 200

Query: 160 XX-------XXXXXXXXXXXDFTLSINSVEPEDVGVYYCQ 192
                               +F+L + SV  ED GVY CQ
Sbjct: 201 ATHDKFRGRVEFFTAEIPKGNFSLRLKSVRTEDKGVYMCQ 240


>ref|XP_003198941.1| PREDICTED: b-cell receptor CD22-like [Danio rerio]
          Length = 319

 Score = 27.3 bits (59), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 115 SVTPGDRVSLSCRASQSISDYLHWYQQKS 143
           SV  GD V+LSC A +S    + WY+  S
Sbjct: 13  SVFTGDTVTLSCDAGRSTVRRIIWYKDSS 41


>ref|XP_684768.2| PREDICTED: butyrophilin-like protein 8-like [Danio rerio]
          Length = 272

 Score = 26.9 bits (58), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 216 NFSLRLKSVRTEDKGVYMCQ 235


>ref|XP_001340824.2| PREDICTED: butyrophilin-like protein 8-like [Danio rerio]
          Length = 246

 Score = 26.9 bits (58), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 173 DFTLSINSVEPEDVGVYYCQ 192
           +F+L + SV  ED GVY CQ
Sbjct: 209 NFSLRLKSVRTEDKGVYMCQ 228


BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|70778726|ref|NP_067474.2| WD repeat domain 8 [Mus musculus]
         (462 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_956187.1| WD repeat-containing protein 8 [Danio rerio]         668   0.0  
ref|XP_003200833.1| PREDICTED: WD repeat-containing protein 20-l...    48   1e-05
ref|NP_001032508.1| transcription initiation factor TFIID subuni...    46   7e-05
ref|XP_001919110.3| PREDICTED: echinoderm microtubule associated...    44   2e-04
ref|XP_003200333.1| PREDICTED: WD repeat-containing protein 20 [...    42   8e-04
ref|NP_998228.1| WD repeat-containing protein 24 [Danio rerio]         41   0.002
ref|XP_003200416.1| PREDICTED: wu:fb77g05 isoform 2 [Danio rerio]      40   0.003
ref|XP_698531.3| PREDICTED: wu:fb77g05 isoform 3 [Danio rerio]         40   0.003
ref|XP_003200415.1| PREDICTED: wu:fb77g05 isoform 1 [Danio rerio]      40   0.003
ref|NP_001003758.1| THO complex subunit 3 [Danio rerio]                40   0.003
ref|NP_571855.1| protein groucho-1 [Danio rerio]                       39   0.010
ref|NP_571087.1| protein groucho-2 [Danio rerio]                       39   0.010
ref|NP_957147.1| WD repeat-containing protein 61 [Danio rerio]         38   0.015
ref|NP_001188350.1| WD repeat-containing protein 47-like [Danio ...    38   0.017
ref|NP_958875.1| pre-mRNA-processing factor 19 [Danio rerio]           38   0.020
ref|NP_001159740.1| WD repeat-containing protein 82 [Danio rerio]      37   0.023
ref|NP_001018418.1| notchless protein homolog 1 [Danio rerio]          37   0.031
ref|NP_998245.1| cell division cycle protein 20 homolog [Danio r...    37   0.043
ref|XP_001922619.3| PREDICTED: WD repeat-containing protein 47 [...    36   0.067
ref|NP_956547.1| fizzy-related protein homolog [Danio rerio]           36   0.069
ref|NP_998214.1| POC1 centriolar protein homolog A [Danio rerio]       36   0.075
ref|NP_998183.1| katanin p80 WD40-containing subunit B1 [Danio r...    35   0.099
ref|XP_001921656.3| PREDICTED: WD repeat-containing protein 26-l...    35   0.12 
ref|NP_956441.2| probable cytosolic iron-sulfur protein assembly...    35   0.13 
ref|NP_571683.1| apoptotic protease-activating factor 1 isoform ...    35   0.17 
ref|NP_001124076.1| transducin-like enhancer of split 2 [Danio r...    34   0.19 
ref|XP_002662201.1| PREDICTED: u4/U6 small nuclear ribonucleopro...    34   0.21 
ref|NP_956049.1| U4/U6 small nuclear ribonucleoprotein Prp4 [Dan...    34   0.21 
ref|NP_998212.1| periodic tryptophan protein 2 homolog [Danio re...    34   0.23 
ref|NP_001017766.1| polycomb protein eed [Danio rerio]                 34   0.24 
ref|NP_998264.1| WD repeat-containing protein 5 [Danio rerio]          33   0.32 
ref|XP_700740.5| PREDICTED: WD repeat-containing protein 20-like...    33   0.33 
ref|XP_692471.3| PREDICTED: transducin-like enhancer protein 1 [...    33   0.34 
ref|NP_001189371.1| WD repeat-containing protein 26 [Danio rerio]      33   0.40 
ref|NP_001008625.1| intraflagellar transport protein 80 homolog ...    33   0.45 
ref|NP_001181857.1| WD repeat-containing protein 33 isoform 1 [D...    33   0.49 
ref|NP_998177.1| chromatin assembly factor 1 subunit B [Danio re...    32   0.73 
ref|NP_991272.1| mitotic checkpoint protein BUB3 [Danio rerio]         32   1.1  
ref|NP_998321.1| actin-related protein 2/3 complex subunit 1B [D...    32   1.1  
ref|XP_696012.3| PREDICTED: sperm-associated antigen 5 [Danio re...    32   1.2  
ref|NP_001076463.1| F-box-like/WD repeat-containing protein TBL1...    31   1.5  
ref|XP_001345204.3| PREDICTED: WD repeat-containing protein 65-l...    31   1.9  
ref|NP_956412.1| POC1 centriolar protein homolog B [Danio rerio]       31   2.3  
ref|NP_001071237.1| WD repeat, SAM and U-box domain-containing p...    31   2.3  
ref|XP_001342078.1| PREDICTED: probable G-protein coupled recept...    31   2.5  
ref|XP_002663392.1| PREDICTED: uncharacterized protein C3orf38 [...    30   2.6  
ref|NP_001007403.1| transducin beta-like protein 3 [Danio rerio]       30   3.8  
ref|NP_958500.1| actin-related protein 2/3 complex subunit 1A [D...    30   5.6  
ref|NP_001002100.1| actin-related protein 2/3 complex subunit 1A...    29   6.2  
ref|XP_682841.5| PREDICTED: coronin-2A-like [Danio rerio]              29   7.7  
ref|NP_001018176.1| WD repeat-containing protein 43 [Danio rerio]      29   8.1  
ref|NP_001002312.1| intraflagellar transport protein 172 homolog...    29   9.2  

>ref|NP_956187.1| WD repeat-containing protein 8 [Danio rerio]
          Length = 446

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 372/452 (82%), Gaps = 11/452 (2%)

Query: 1   MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLYTCLDQIQHIEWSADS 60
           MNFSE FK S  LC+ SPDGKYLA+CVQYRLV+RD+ TLQI+ LYTCLDQ+ H+EWS+DS
Sbjct: 1   MNFSEVFKQSNQLCKVSPDGKYLATCVQYRLVVRDIGTLQIVHLYTCLDQVMHMEWSSDS 60

Query: 61  LFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS 120
           LFILCA+Y+RGLVQVWSLEQP+WHCKIDEGS GLV+S WSPDGRHILNTTEF+LRITVWS
Sbjct: 61  LFILCAVYKRGLVQVWSLEQPDWHCKIDEGSIGLVSSRWSPDGRHILNTTEFNLRITVWS 120

Query: 121 LCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQD 180
           LCTKSVSYIKYPKACQ+G+ FT DGRY+ALAERRDC+DY+S+FVC DW LLRHF+++TQD
Sbjct: 121 LCTKSVSYIKYPKACQKGMDFTADGRYMALAERRDCKDYISVFVCDDWHLLRHFESETQD 180

Query: 181 LTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAI 240
           L G+EW+PNGCVLA WD CLEYK+LLYSLDGRLLS Y AYEWSLGIKSVAWSPSSQFLAI
Sbjct: 181 LAGLEWSPNGCVLAVWDNCLEYKILLYSLDGRLLSFYSAYEWSLGIKSVAWSPSSQFLAI 240

Query: 241 GSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPL----LGLGHLSFPPPRA 296
           GSYD KVR+LNH+TWK ITEF HPATI N K VV+KE EK P+    L +  L+      
Sbjct: 241 GSYDEKVRILNHITWKKITEFEHPATITNSKAVVFKEVEKRPVVSEDLSIRQLT------ 294

Query: 297 MAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAV 356
           +  AL +++SKYEI   PV +  +KP  +RANP++G+  +AFS+D+ +LA++NDN+P ++
Sbjct: 295 VDNALFSTQSKYEITQLPVQVPVVKPDPERANPKIGISAVAFSADNRYLATKNDNMPQSL 354

Query: 357 WIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEGDF 416
           W+WD+QK  L  VLE  +PVR F WDP  PRLA+CTG +K+Y+WSPAGC+SV VP EG F
Sbjct: 355 WVWDMQKFSLLAVLEQTAPVRCFVWDPHLPRLALCTGNTKLYMWSPAGCISVTVPVEG-F 413

Query: 417 PVLGLCWHLSGDSLALLSKDHFCLCFLETKER 448
            V  L WH +G SL LLSKD  CLC+ + +E+
Sbjct: 414 QVQSLFWHCTGSSLVLLSKDQLCLCYTDAEEQ 445


>ref|XP_003200833.1| PREDICTED: WD repeat-containing protein 20-like [Danio rerio]
          Length = 572

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 51  IQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTT 110
           +    +S D  F+ CA  + G ++V+  +  E H  +     GL+  CWSPDGR+I+   
Sbjct: 223 VNEFAFSPDGKFLACAG-QDGFLRVFCFDSAELHGTMKSYFGGLLCVCWSPDGRYIVTGG 281

Query: 111 EFHLRITVWSLCTKSV 126
           E  L +TVWS     V
Sbjct: 282 EDDL-VTVWSFSDSRV 296


>ref|NP_001032508.1| transcription initiation factor TFIID subunit 5 [Danio rerio]
          Length = 743

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 92/197 (46%), Gaps = 20/197 (10%)

Query: 79  EQPEWHCKIDEGSAGLV-ASCWSPDGRHILNTTEFHLRITVWSLCTKS--VSYI--KYPK 133
           E+     KI  G +G V    +SPD  ++L+++E    I +WSL T +  V Y    YP 
Sbjct: 473 EKTSSESKILHGHSGPVYGVSFSPDRNYLLSSSE-DGTIRLWSLQTFTCLVGYKGHNYPV 531

Query: 134 ACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSD-WQLLRHFDTDTQDLTGIEWAPNGCV 192
              Q   F+  G Y          D V+    +D +Q LR F     D+T   + PN   
Sbjct: 532 WDTQ---FSPFGYYFVSG----GHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNY 584

Query: 193 LAAWDTCLEYKVLLYS-LDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKVRLLN 251
           +A   +  +  V L+  L+G  +  +  ++    I S+A+SP+ +FLA GS DG+V L +
Sbjct: 585 VATGSS--DRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFSPNGKFLASGSTDGRVLLWD 640

Query: 252 HVTWKMITEF-GHPATI 267
                MI E  GH  TI
Sbjct: 641 IGHGLMIAELKGHTGTI 657


>ref|XP_001919110.3| PREDICTED: echinoderm microtubule associated protein like 6 [Danio
           rerio]
          Length = 1734

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 57/155 (36%), Gaps = 11/155 (7%)

Query: 273 VVYKEAEKSPLLGLGH------LSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADR 326
           VVY   E +    LGH      L+  P +         +  Y       +L T+  + D 
Sbjct: 45  VVYNTREHTQKFYLGHNDDIISLALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDV 104

Query: 327 ANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQ 385
                GV  LAF +D   LAS   +  N V +WD +K ++      H   +    WDP  
Sbjct: 105 HT--HGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFL 162

Query: 386 PRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG 420
           P   +  G   +  W  A C +   P  G F   G
Sbjct: 163 PHRLVSCGVKHIKFW--ALCGNALTPKRGIFGKTG 195


>ref|XP_003200333.1| PREDICTED: WD repeat-containing protein 20 [Danio rerio]
          Length = 596

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 51  IQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTT 110
           +    +S D  F L  + + G ++V++ +  E H  +     GL+  CWSPDG++I+   
Sbjct: 226 LNEFAFSPDGKF-LAVVSQDGFLRVFNFDAVELHGTMKSYFGGLLCVCWSPDGKYIVAGG 284

Query: 111 EFHLRITVWSL 121
           E  L +TVWS 
Sbjct: 285 EDDL-VTVWSF 294



 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 221 EWSLG---IKSVAWSPSSQFLAIGSYDGKVRLLN 251
           +W++G   +   A+SP  +FLA+ S DG +R+ N
Sbjct: 218 KWTVGDGALNEFAFSPDGKFLAVVSQDGFLRVFN 251


>ref|NP_998228.1| WD repeat-containing protein 24 [Danio rerio]
          Length = 779

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 7/107 (6%)

Query: 49  DQIQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASC-WSPDGRHIL 107
           + ++ +++S    F   A +  G VQ+W + +P+ + ++     G V  C W P+ R  L
Sbjct: 158 ESVRDVQFSMKDYFTFAASFENGNVQLWDIRRPDRYERMFTAHTGPVFCCDWHPEDRGWL 217

Query: 108 NTTEFHLRITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERR 154
            T      + VW + T  V  I     C Q  TF    R     ERR
Sbjct: 218 ATGGRDKMVKVWDMSTNRVKEI----YCVQ--TFASVARVKWRPERR 258


>ref|XP_003200416.1| PREDICTED: wu:fb77g05 isoform 2 [Danio rerio]
          Length = 1959

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 58/156 (37%), Gaps = 13/156 (8%)

Query: 273 VVYKEAEKSPLLGLGH------LSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADR 326
           VVY   E      LGH      L+  P R +       +  Y       ++QT+  + D 
Sbjct: 45  VVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDM 104

Query: 327 ANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDP-Q 384
                G+  LAF  D   L S   +  N + +WD ++ K+      H   +    WD  Q
Sbjct: 105 HT--HGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQ 162

Query: 385 QPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG 420
           Q +L  C G   +  WS   C +   P  G F   G
Sbjct: 163 QSKLVSC-GVKHIKFWSL--CGNALTPKRGVFGKTG 195


>ref|XP_698531.3| PREDICTED: wu:fb77g05 isoform 3 [Danio rerio]
          Length = 1974

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 58/156 (37%), Gaps = 13/156 (8%)

Query: 273 VVYKEAEKSPLLGLGH------LSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADR 326
           VVY   E      LGH      L+  P R +       +  Y       ++QT+  + D 
Sbjct: 45  VVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDM 104

Query: 327 ANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDP-Q 384
                G+  LAF  D   L S   +  N + +WD ++ K+      H   +    WD  Q
Sbjct: 105 HT--HGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQ 162

Query: 385 QPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG 420
           Q +L  C G   +  WS   C +   P  G F   G
Sbjct: 163 QSKLVSC-GVKHIKFWSL--CGNALTPKRGVFGKTG 195


>ref|XP_003200415.1| PREDICTED: wu:fb77g05 isoform 1 [Danio rerio]
          Length = 1966

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 58/156 (37%), Gaps = 13/156 (8%)

Query: 273 VVYKEAEKSPLLGLGH------LSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADR 326
           VVY   E      LGH      L+  P R +       +  Y       ++QT+  + D 
Sbjct: 45  VVYNTREHKQKFYLGHNDDIISLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDM 104

Query: 327 ANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDP-Q 384
                G+  LAF  D   L S   +  N + +WD ++ K+      H   +    WD  Q
Sbjct: 105 HT--HGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQ 162

Query: 385 QPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG 420
           Q +L  C G   +  WS   C +   P  G F   G
Sbjct: 163 QSKLVSC-GVKHIKFWSL--CGNALTPKRGVFGKTG 195


>ref|NP_001003758.1| THO complex subunit 3 [Danio rerio]
          Length = 322

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 104/257 (40%), Gaps = 40/257 (15%)

Query: 223 SLGIKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEF---GHPATIN-------NPKT 272
           S  + SVAWS   + LA GS+D    +      +++ E    GH  +++       NP  
Sbjct: 26  SAKVHSVAWSCDGKRLASGSFDKTASVFVLEKDRLVKENNYRGHGDSVDQLCWHPTNPDL 85

Query: 273 VVYKEAEKSPLLGLGHLSFPPPRAMAGALSTSESKYEIASGP----------------VS 316
            V    +K+  +          + MA  +ST      I   P                + 
Sbjct: 86  FVTASGDKTIRI----WDVRTTKCMA-TVSTKGENINICWSPDGQTIAVGNKDDVVTFID 140

Query: 317 LQTLKPVADRANPRMGVGMLAFSSDS--YFLASRNDNVPNAVWIWDIQKLKLFVVLE-HM 373
            +T +P A+    +  V  +++++D+  +FL + N      + I    +LKL   +  H 
Sbjct: 141 AKTHRPRAEE-QFKFEVNEISWNNDNDMFFLTNGN----GCINILSYPELKLIQSINAHP 195

Query: 374 SPVRSFQWDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALL 433
           S     ++DP     A  +  + V LW+    V V+     D+PV  L +   G  LA  
Sbjct: 196 SNCICIKFDPTGKYFATGSADALVSLWNVEELVCVRCFSRLDWPVRTLSFSHDGKMLASA 255

Query: 434 SKDHFC-LCFLETKERV 449
           S+DHF  +  +ET E++
Sbjct: 256 SEDHFIDIAEVETGEKL 272



 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 10/128 (7%)

Query: 333 VGMLAFSSDSYFLASRNDNVPNAVWIWDIQKL-KLFVVLEHMSPVRSFQWDPQQPRLAIC 391
           V  +A+S D   LAS + +   +V++ +  +L K      H   V    W P  P L + 
Sbjct: 29  VHSVAWSCDGKRLASGSFDKTASVFVLEKDRLVKENNYRGHGDSVDQLCWHPTNPDLFVT 88

Query: 392 TGGSK-VYLWS--PAGCV-SVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFCLCFLETKE 447
             G K + +W      C+ +V   GE     + +CW   G ++A+ +KD   + F++ K 
Sbjct: 89  ASGDKTIRIWDVRTTKCMATVSTKGEN----INICWSPDGQTIAVGNKDDV-VTFIDAKT 143

Query: 448 RVGTAYEQ 455
               A EQ
Sbjct: 144 HRPRAEEQ 151


>ref|NP_571855.1| protein groucho-1 [Danio rerio]
          Length = 771

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 86/200 (43%), Gaps = 32/200 (16%)

Query: 70  RGLVQVWSLEQPEWHCKIDE----GSAGLVASC-WSPDGRHILNTTEFHLRITVWSLCTK 124
           +G V++W + QP     + +         + SC   PDGR ++   E    +T+W L ++
Sbjct: 505 KGCVKIWDISQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEAST-LTIWDLASQ 563

Query: 125 SVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQ----------LLRHF 174
           +          +  LT +    Y ALA   D +  V    CSD            L+R F
Sbjct: 564 T-------PRIKAELTSSAPACY-ALAISPDAK--VCFSCCSDGNIAVWDLHNQTLVRQF 613

Query: 175 DTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSP 233
              T   + I+ + +G  L  W   L+  V  + L +GR L  +   +++  I S+ + P
Sbjct: 614 QGHTDGASCIDISHDGTKL--WTGGLDNTVRSWDLREGRQLQQH---DFTSQIFSLGYCP 668

Query: 234 SSQFLAIGSYDGKVRLLNHV 253
           + ++LA+G     V +L+H 
Sbjct: 669 TGEWLAVGMESSNVEVLHHT 688


>ref|NP_571087.1| protein groucho-2 [Danio rerio]
          Length = 761

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 88/200 (44%), Gaps = 32/200 (16%)

Query: 70  RGLVQVWSLEQPEWHCKIDE----GSAGLVASC-WSPDGRHILNTTEFHLRITVWSLCTK 124
           +G V++W + QP     + +         + SC   PDGR ++   E    +T+W L ++
Sbjct: 495 KGCVKIWDISQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEAST-LTIWDLASQ 553

Query: 125 SVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQ----------LLRHF 174
           +      P+  +  LT +    Y ALA   D +  V    CSD            L+R F
Sbjct: 554 T------PR-IKAELTSSAPACY-ALAISPDAK--VCFSCCSDGNIAVWDLHNQTLVRQF 603

Query: 175 DTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSP 233
              T   + I+ + +G  L  W   L+  V  + L +GR L  +   +++  I S+ + P
Sbjct: 604 QGHTDGASCIDISHDGTKL--WTGGLDNTVRSWDLREGRQLQQH---DFASQIFSLGYCP 658

Query: 234 SSQFLAIGSYDGKVRLLNHV 253
           + ++LA+G     V +L+H 
Sbjct: 659 TGEWLAVGMESSNVEVLHHT 678


>ref|NP_957147.1| WD repeat-containing protein 61 [Danio rerio]
          Length = 305

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 104/233 (44%), Gaps = 35/233 (15%)

Query: 181 LTGIEWAPNGCVLAAWDTCLEYKVLLYSLD-GRLLSAYCAYEWSLGIKSVAWSPSSQFLA 239
           +  +  + NG + A+  + L+  + L+ L+ G+ + +  A    +   +VA+SP S+++A
Sbjct: 67  VVSVNISQNGAIAAS--SSLDAHIRLWDLETGKQIKSMDAGP--VDAWTVAFSPDSKYIA 122

Query: 240 IGSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPLLGLGHLSFPPPRAMA- 298
            GS+ GKV +           FG    + + K     +     +L + +   P  + +A 
Sbjct: 123 TGSHLGKVNI-----------FG----VESGKKEHSLDTRGKFILSIAY--SPDGKYLAS 165

Query: 299 GALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAVWI 358
           GA+    + ++IA+G + L TL+  A      M +  L FS DS  L + +D+    + I
Sbjct: 166 GAIDGIINIFDIATGKL-LHTLEGHA------MPIRSLTFSPDSQLLVTASDD--GYIKI 216

Query: 359 WDIQKLKLFVVLE-HMSPVRSFQWDPQQPRLAICTGGSKVYLW--SPAGCVSV 408
           +D+Q   L   L  H S V S  + P        +    + +W  S   CV+ 
Sbjct: 217 YDVQHANLAGTLSGHGSWVLSVAFSPDDTHFVSSSSDKSIKVWDTSSRSCVNT 269



 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 12  LLCRFSPDGKYLAS-CVQYRLVIRDVTTLQILQ-LYTCLDQIQHIEWSADSLFILCAMYR 69
           L   +SPDGKYLAS  +   + I D+ T ++L  L      I+ + +S DS  ++ A   
Sbjct: 152 LSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTAS-D 210

Query: 70  RGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKS 125
            G ++++ ++       +    + +++  +SPD  H ++++     I VW   ++S
Sbjct: 211 DGYIKIYDVQHANLAGTLSGHGSWVLSVAFSPDDTHFVSSSS-DKSIKVWDTSSRS 265



 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 79/182 (43%), Gaps = 38/182 (20%)

Query: 226 IKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMI-TEFGHPATINNPKTVVYKEAEKSPLL 284
           I S+A+SP  ++LA G+ DG + + +  T K++ T  GH   I +               
Sbjct: 151 ILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRS--------------- 195

Query: 285 GLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVG----MLAFS- 339
               L+F P   +   ++ S+  Y      + +  ++  A+ A    G G     +AFS 
Sbjct: 196 ----LTFSPDSQL--LVTASDDGY------IKIYDVQH-ANLAGTLSGHGSWVLSVAFSP 242

Query: 340 SDSYFLASRNDNVPNAVWIWDIQKLK-LFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVY 398
            D++F++S +D    ++ +WD      +    +H   V S +++P   ++        ++
Sbjct: 243 DDTHFVSSSSD---KSIKVWDTSSRSCVNTFFDHQDQVWSVKYNPTGSKIVSAGDDRAIH 299

Query: 399 LW 400
           ++
Sbjct: 300 IY 301


>ref|NP_001188350.1| WD repeat-containing protein 47-like [Danio rerio]
          Length = 871

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 16/95 (16%)

Query: 188 PNGCVLAAWDTCLEY-KVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDG 245
           P+G ++A   T LE  + +LY +  GR +  Y  +  S  ++SV +SP + +L  GSYD 
Sbjct: 762 PSGRLMA---TGLEDCRCMLYDIRGGRSVQVYRPH--SSDVRSVRFSPGAHYLLTGSYDS 816

Query: 246 KVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEK 280
           +V         MI++     T N P TVV + A+K
Sbjct: 817 RV---------MISDLQGDLTKNLPVTVVAEHADK 842


>ref|NP_958875.1| pre-mRNA-processing factor 19 [Danio rerio]
          Length = 505

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 356 VWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEG 414
           V ++D ++ ++   L+ H   V S  + P Q  +   +  S + +WS  G   VQV    
Sbjct: 247 VVVFDRREEQIVATLKGHTKKVSSVIYHPAQAVVFSASSDSTIRVWSVTGGNCVQVVRAH 306

Query: 415 DFPVLGLCWHLSGDSLALLSKDHF 438
           +  V GL  H +GD L   S+D +
Sbjct: 307 ESAVTGLSLHATGDYLLSSSEDQY 330



 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 10/139 (7%)

Query: 73  VQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCT-KSVSYIKY 131
           +++W L++          S  + A  +S +G + L T      + +W L   K+   I  
Sbjct: 375 IKIWDLKERTNVANFPGHSGPVTAIAFSENG-YYLATGAQDSSLKLWDLRKLKNFKTITL 433

Query: 132 PKACQ-QGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNG 190
               + + L F + G YLA+    D R    +++C  W  + +F   +  +TG+ +  + 
Sbjct: 434 DNNYEVKSLVFDQSGTYLAVG-GSDIR----VYICKQWSEVLNFSDHSGLVTGVAFGEHA 488

Query: 191 CVLAAWDTCLEYKVLLYSL 209
             LA+  T ++  +  YSL
Sbjct: 489 QFLAS--TGMDRSLKFYSL 505


>ref|NP_001159740.1| WD repeat-containing protein 82 [Danio rerio]
          Length = 313

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 182 TGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLG-IKSVAWSPSSQFLAI 240
           TG++++ +G ++         +VL  +  G +L ++  Y  S G I   +++P SQF+ I
Sbjct: 198 TGLKFSNDGKLILVSTNGGTLRVL-DAFKGAVLHSFGGYNNSKGVILEASFTPDSQFIMI 256

Query: 241 GSYDGKVRLLN 251
           GS DGK+ + N
Sbjct: 257 GSEDGKIHVWN 267


>ref|NP_001018418.1| notchless protein homolog 1 [Danio rerio]
          Length = 476

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 6/122 (4%)

Query: 321 KPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSF 379
           KPVA     +  V  + FS D+  +AS   +   ++ IWD +  K    L  H+ PV   
Sbjct: 354 KPVARLTGHQALVNEVLFSPDTRLIASA--SFDKSIKIWDGKTGKYLNSLRGHVGPVYQV 411

Query: 380 QWDPQQPRLAICTGGSKVYLWS-PAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHF 438
            W      L   +  S + +W    G ++  +PG  D  V  + W   G  +A   KD  
Sbjct: 412 AWSADSRLLVSGSSDSTLKVWDIKTGKLNADLPGHAD-EVFAVDWSPDGQRVASGGKDK- 469

Query: 439 CL 440
           CL
Sbjct: 470 CL 471



 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 16  FSPDGKYLASC-VQYRLVIRDVTTLQILQ-LYTCLDQIQHIEWSADSLFILCAMYRRGLV 73
           FSPD + +AS      + I D  T + L  L   +  +  + WSADS  ++       L 
Sbjct: 371 FSPDTRLIASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTL- 429

Query: 74  QVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHI 106
           +VW ++  + +  +   +  + A  WSPDG+ +
Sbjct: 430 KVWDIKTGKLNADLPGHADEVFAVDWSPDGQRV 462



 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 43/109 (39%), Gaps = 7/109 (6%)

Query: 336 LAFSSDSYFLASRNDNVPNAVWIWDIQ-KLKLFVVLEHMSPVRSFQWDPQQPRLAICTGG 394
           +AFS    +LAS + +    V  WD+  +        H   V S  W P   +LA     
Sbjct: 111 VAFSPTGKYLASGSGDT--TVRFWDLSTETPHHTSRGHTHWVLSIAWSPDGKKLASGCKN 168

Query: 395 SKVYLWSPAGCVSVQVPGEGDFP-VLGLCW---HLSGDSLALLSKDHFC 439
           S+++LW P     +     G    +  LCW   HL+ +   L S    C
Sbjct: 169 SQIFLWDPVTGKQIGKTLTGHTKWITWLCWEPLHLNPECRYLASTSKDC 217


>ref|NP_998245.1| cell division cycle protein 20 homolog [Danio rerio]
          Length = 496

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 77/192 (40%), Gaps = 37/192 (19%)

Query: 226 IKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEF-GHPATINNPKTVVYKEAEKSPLL 284
           I SV+WS    FLAIG+ D KV L +    K +    GH A +                 
Sbjct: 230 ICSVSWSKDGNFLAIGTSDCKVELWDVQYQKRLRSMDGHSARV----------------- 272

Query: 285 GLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYF 344
             G LS+      +G+ S    ++++      + T             V  L +S D  +
Sbjct: 273 --GCLSWNDHILSSGSRSGLIHQHDVRVADHHIFTF------GGHTQEVCGLTWSPDGRY 324

Query: 345 LASRNDNVPNAVWIWDI----QKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSK---V 397
           LAS  ++  N ++IW +    +   +  + EH   V++  W P QP +    GG+    +
Sbjct: 325 LASGGND--NMMYIWPMTTGSENQAIHALSEHQGAVKALAWCPWQPNIPASGGGTSDRHI 382

Query: 398 YLW--SPAGCVS 407
            +W  S   C+S
Sbjct: 383 RIWNASSGSCIS 394


>ref|XP_001922619.3| PREDICTED: WD repeat-containing protein 47 [Danio rerio]
          Length = 902

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 14/94 (14%)

Query: 188 PNGCVLAAWDTCLEYKVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGK 246
           P+G +LA      +   +LY +  GR++  Y  +  S  ++SV +SP + +L  GSYD K
Sbjct: 793 PSGRLLATGQE--DSSCMLYDIRGGRMVQTYKPH--SSDVRSVRFSPGAHYLLTGSYDNK 848

Query: 247 VRLLNHVTWKMITEFGHPATINNPKTVVYKEAEK 280
           V         ++T+     T   P TVV +  +K
Sbjct: 849 V---------IVTDLQGDLTKQLPLTVVGEHGDK 873


>ref|NP_956547.1| fizzy-related protein homolog [Danio rerio]
          Length = 495

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 73/172 (42%), Gaps = 28/172 (16%)

Query: 226 IKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEF-GHPATINNPKTVVYKEAEKSPLL 284
           + SV WS     +A+G++ G V++ +    K +    GH A +                 
Sbjct: 234 VTSVGWSERGNLVAVGTHKGFVQIWDATAGKKLFALEGHTARV----------------- 276

Query: 285 GLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYF 344
             G L++   +  +G+      + +I + P  LQ+ + +      R  V  L +S+D   
Sbjct: 277 --GALAWNADQLSSGSRDRMILQRDIRTPP--LQSERRLQGH---RQEVCGLKWSTDHQL 329

Query: 345 LASRNDNVPNAVWIWDIQK-LKLFVVLEHMSPVRSFQWDPQQPRLAICTGGS 395
           LAS  ++  N + +W+    L +    EH++ V++  W P Q  L    GG+
Sbjct: 330 LASGGND--NKLLVWNHSSVLPMQQYTEHLAAVKAIAWSPHQHGLLASGGGT 379


>ref|NP_998214.1| POC1 centriolar protein homolog A [Danio rerio]
          Length = 416

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 124/291 (42%), Gaps = 30/291 (10%)

Query: 15  RFSPDGKYLASCVQ---YRLVIRDVTTLQILQLYTCLDQIQHIEWSADSLFILCAMYRRG 71
           +FSP    LAS  +    RL +  V    +L        ++ + +SAD   +L A   + 
Sbjct: 67  QFSPSAHLLASSSRDKTVRLWVPSVKGESVL-FRAHTGSVRSVCFSADGQSLLTASDDQS 125

Query: 72  LVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIK- 130
            +++WS+ + +  C + E +  +  + +SPDG+ +++ ++    + +W   ++ + +   
Sbjct: 126 -IKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRT-VKLWDASSRQLIHTFC 183

Query: 131 YPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNG 190
            P      + F      +A A      + V ++      LL+H+   +  +  + + P+G
Sbjct: 184 EPGGYSSYVDFHPSSTCIATAS---SDNTVRVWDIRTHTLLQHYQVHSAAVNALSFHPSG 240

Query: 191 CVL--AAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKV- 247
             L  A+ D+ L+   +L  L+GRLL     ++ S    S + S   QF + GS D +V 
Sbjct: 241 NHLLTASSDSTLK---ILDLLEGRLLYTLHGHQGSASCVSFSRS-GDQFASAGS-DQQVM 295

Query: 248 ------------RLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPLLGL 286
                       R+L                  +P++   ++ E SPLLG+
Sbjct: 296 VWRTNFDSVDYSRVLQQKRDHRTPSAQASGAAGDPESRSGQKTEVSPLLGV 346


>ref|NP_998183.1| katanin p80 WD40-containing subunit B1 [Danio rerio]
          Length = 694

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 16  FSPDGKYLASCVQYRLV-IRDVTTLQILQLYTCLDQIQHIEWSADSLFILCAMYRRGLVQ 74
           FSPDGK+LAS      V + D+   +++  +T      ++     + ++L +      V+
Sbjct: 155 FSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVK 214

Query: 75  VWSLEQPEWHCKIDEGSAGLVASC-WSPDGRHILNTTEFHLRITVW 119
           +W LE+        EG  G+V S  ++PDG  + + +E  LR+  W
Sbjct: 215 LWDLEKFNM-IGSSEGETGVVRSVLFNPDGSCLYSGSENTLRVYGW 259



 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 169 QLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEW---SLG 225
           ++LR        ++ +++ P G  LA+       K+      G      C + +   +  
Sbjct: 96  KILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKG------CVFRYKGHTQA 149

Query: 226 IKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEF-GHPATIN 268
           ++ +A+SP  ++LA  S D  V+L + +  KMITEF  H + +N
Sbjct: 150 VRCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVN 193



 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 336 LAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVL-EHMSPVRSFQWDPQQPRLAICTGG 394
           LAFS D  +LAS +D+  + V +WD+   K+      H S V   Q+ P +  LA  +  
Sbjct: 153 LAFSPDGKWLASASDD--STVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSAD 210

Query: 395 SKVYLW 400
             V LW
Sbjct: 211 RTVKLW 216


>ref|XP_001921656.3| PREDICTED: WD repeat-containing protein 26-like [Danio rerio]
          Length = 474

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 295 RAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYFLASRNDNVPN 354
           +  +G+  T+   +++      L+ LK +   A    GV  LA+S D  +L +   +  +
Sbjct: 179 KLASGSKDTTVIIWQVDPDSQQLKQLKTLEGHA---YGVSYLAWSPDDTYLIACGPDDCS 235

Query: 355 AVWIWDIQ--KLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSK 396
            +W+W++Q  +L+  +   H   + S  W+P   R    TGG +
Sbjct: 236 ELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFV--TGGQR 277


>ref|NP_956441.2| probable cytosolic iron-sulfur protein assembly protein ciao1
           [Danio rerio]
          Length = 330

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 8/121 (6%)

Query: 333 VGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQPRLAIC 391
           V  +A+S    +LAS + +    +W    +  +   VLE H + V+   W P    LA C
Sbjct: 64  VRKVAWSPCGKYLASASFDATTCIWKKTDEDFECLTVLEGHENEVKCVAWAPSGSLLATC 123

Query: 392 TGGSKVYLW-----SPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFCLCFLETK 446
           +    V++W         C+SV      D  V  + WH + + LA  S D+    + E  
Sbjct: 124 SRDKSVWIWEVDEEDEYECLSVVNSHTQD--VKHVVWHPTQELLASASYDNKICIYKEED 181

Query: 447 E 447
           +
Sbjct: 182 D 182



 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 11/108 (10%)

Query: 145 GRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYK- 203
           G+YLA A   D    +      D++ L   +    ++  + WAP+G +LA   TC   K 
Sbjct: 73  GKYLASASF-DATTCIWKKTDEDFECLTVLEGHENEVKCVAWAPSGSLLA---TCSRDKS 128

Query: 204 VLLYSLDGR----LLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKV 247
           V ++ +D       LS   ++  +  +K V W P+ + LA  SYD K+
Sbjct: 129 VWIWEVDEEDEYECLSVVNSH--TQDVKHVVWHPTQELLASASYDNKI 174


>ref|NP_571683.1| apoptotic protease-activating factor 1 isoform 2 [Danio rerio]
          Length = 1261

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 149/387 (38%), Gaps = 72/387 (18%)

Query: 56   WSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLR 115
            WSAD   I+CA   R  V V+ +E  +   K+       +  C +     +L     H  
Sbjct: 808  WSADGSQIICAA--RNTVFVFDVETSDLLLKLKTSRLSTIQFCHACPNSSLLAVALSHYT 865

Query: 116  ITVWSL--------CTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSD 167
            + +W+         C+  +S++     C Q   F+ DG  L                 SD
Sbjct: 866  VELWNFESSKKKAECSGHLSWVH----CVQ---FSPDGSLL--------------LSSSD 904

Query: 168  WQLLRHFDTDT---------QDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYC 218
             Q +R ++TD          +  T +  + +   + A D+    +VL  S    +L +  
Sbjct: 905  DQTIRLWETDRVHTSSAVALKRDTDVLSSHSDATIIAPDSSNRLQVLSGSTGAVVLESE- 963

Query: 219  AYEWSLGIKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEF-GHPATINNPK-----T 272
              E S  I+    S ++ F+A+GS DG V+++   + K   +  GH  T+++ +      
Sbjct: 964  --ELSSRIRCSCISRNAAFVALGSEDGTVQVIEVPSSKASVKLSGHTKTVHHCQFTDDCE 1021

Query: 273  VVYKEAEKSP-----------LLGLGHLSFPPPRAMAGALSTSESKYEIAS--GPVSLQT 319
            ++   +E S            ++  GH+   P R      S+S       S  G V +  
Sbjct: 1022 ILITSSEDSTIRVWKWRTGECMVLQGHME--PVRKFHLLSSSSSPHLFSWSFDGTVKVWD 1079

Query: 320  L---KPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLEHMSPV 376
            L   + + D       V     SSD    A+ + N    VW     K+ LF++  H   V
Sbjct: 1080 LTRGQMLQDLVCHEGAVLSCDVSSDGRLFATTSANRTAKVWSSASWKM-LFLLEGHKDCV 1138

Query: 377  RS--FQWDPQQPRLAICTGGSKVYLWS 401
            RS  F WD +  RLA      ++ LWS
Sbjct: 1139 RSCRFSWDNK--RLATGDDNGEIRLWS 1163



 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 87/408 (21%), Positives = 161/408 (39%), Gaps = 59/408 (14%)

Query: 12   LLCRFSPDGKYLASCVQYRLV-IRDVTTLQILQLYTCL--DQIQHIEWSADSLFIL---C 65
            L C FSPD +++A+C   R V + +V    +++ +     +QI H +++     +L   C
Sbjct: 663  LCCAFSPDDRHIATCASDRKVKLWNVERGVLIREFEVEHEEQINHCQFTNTGRRVLLATC 722

Query: 66   AMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTE------FHLR---- 115
            +  +    ++W+  +      +      +   C+SP+  ++  ++       F +     
Sbjct: 723  SNDKFTNTRLWNPNKKTSQNTMFGHMEPVNHCCFSPNDLYLATSSSDGSLKLFEVSSANE 782

Query: 116  ---ITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLR 172
               I V S   +S   IK    C    T++ DG  +  A     R+ V +F      LL 
Sbjct: 783  WKSIDVDSFFPESDEEIKAMVKCS---TWSADGSQIICA----ARNTVFVFDVETSDLL- 834

Query: 173  HFDTDTQDLTGIEWA---PNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSV 229
                 T  L+ I++    PN  +LA       Y V L++ +     A C+   S  +  V
Sbjct: 835  -LKLKTSRLSTIQFCHACPNSSLLAV--ALSHYTVELWNFESSKKKAECSGHLSW-VHCV 890

Query: 230  AWSPSSQFLAIGSYDGKVRL--------LNHVTWKMITEF---GHPATINNPKTV----V 274
             +SP    L   S D  +RL         + V  K  T+       ATI  P +     V
Sbjct: 891  QFSPDGSLLLSSSDDQTIRLWETDRVHTSSAVALKRDTDVLSSHSDATIIAPDSSNRLQV 950

Query: 275  YKEAEKSPLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMG-- 332
               +  + +L    LS    R     +S + +   + S   ++Q ++  + +A+ ++   
Sbjct: 951  LSGSTGAVVLESEELS---SRIRCSCISRNAAFVALGSEDGTVQVIEVPSSKASVKLSGH 1007

Query: 333  ---VGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLEHMSPVR 377
               V    F+ D   L + +++    VW W  +  +  V+  HM PVR
Sbjct: 1008 TKTVHHCQFTDDCEILITSSEDSTIRVWKW--RTGECMVLQGHMEPVR 1053


>ref|NP_001124076.1| transducin-like enhancer of split 2 [Danio rerio]
          Length = 811

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 86/201 (42%), Gaps = 33/201 (16%)

Query: 70  RGLVQVWSLEQPEWHCKIDE----GSAGLVASC-WSPDGRHILNTTEFHLRITVWSLCTK 124
           +G V+VW + QP     + +         + SC   PDGR ++   E    +++W L T 
Sbjct: 545 KGCVKVWDISQPGSKSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEAST-LSIWDLATP 603

Query: 125 SVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQ----------LLRHF 174
           +          +  LT +    Y ALA   D +  V    CSD            L+R F
Sbjct: 604 T-------PRIKAELTSSAPACY-ALAISPDNK--VCFSCCSDGNIVVWDLHNQTLVRQF 653

Query: 175 DTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSP 233
              T   + I+ + +G  L  W   L+  V  + L +GR L     ++++  I S+ + P
Sbjct: 654 QGHTDGASCIDISNDGTKL--WTGGLDNTVRCWDLREGRQLQ---QHDFTSQIFSLGYCP 708

Query: 234 SSQFLAIGSYDGKVRLLNHVT 254
           + ++LA+G     V +L HV+
Sbjct: 709 TGEWLAVGMESSNVEVL-HVS 728


>ref|XP_002662201.1| PREDICTED: u4/U6 small nuclear ribonucleoprotein Prp4-like [Danio
           rerio]
          Length = 507

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 107/272 (39%), Gaps = 31/272 (11%)

Query: 14  CRFSPDGKYLASCVQYRLV----IRDVTTLQILQLYTCLDQIQHIEWSADSLFIL----- 64
           C+FSP+ K L +     L     + D T ++ L+ +     +  I +   +   L     
Sbjct: 222 CQFSPNSKLLVTASWSGLCKLWKVPDCTLIRTLRGHNT--NVGAISFHPQATLTLEESDV 279

Query: 65  ----CAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS 120
               CA    G V++WSL+  E    I+  S  +    W P GR  L TT +     +W 
Sbjct: 280 NMASCAA--DGSVKLWSLDSDEPIADIEGHSMRVARVTWHPSGR-FLGTTCYDHSWRLWD 336

Query: 121 LCTKSVSYIKYPKACQQG---LTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTD 177
           L  +    I + +   +G   L F  DG   +LA       +  ++     + +   +  
Sbjct: 337 LEVQ--EEILHQEGHSKGVHDLHFHPDG---SLAGTGGLDSFARVWDLRTGRCVMFLEGH 391

Query: 178 TQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSS-Q 236
            +++  I ++PNG  +A        KV  + L  R          +L + SV + P+   
Sbjct: 392 IKEIYSINFSPNGFHVATGSGDNACKV--WDLRQRRCIYTIPAHQNL-VSSVKFQPNDGH 448

Query: 237 FLAIGSYDGKVRLLNHVTWK-MITEFGHPATI 267
           +L  G+YD   ++  H  W  + T  GH   +
Sbjct: 449 YLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKV 480


>ref|NP_956049.1| U4/U6 small nuclear ribonucleoprotein Prp4 [Danio rerio]
          Length = 507

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 107/272 (39%), Gaps = 31/272 (11%)

Query: 14  CRFSPDGKYLASCVQYRLV----IRDVTTLQILQLYTCLDQIQHIEWSADSLFIL----- 64
           C+FSP+ K L +     L     + D T ++ L+ +     +  I +   +   L     
Sbjct: 222 CQFSPNSKLLVTASWSGLCKLWKVPDCTLIRTLRGHNT--NVGAISFHPQATLTLEESDV 279

Query: 65  ----CAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS 120
               CA    G V++WSL+  E    I+  S  +    W P GR  L TT +     +W 
Sbjct: 280 NMASCAA--DGSVKLWSLDSDEPIADIEGHSMRVARVTWHPSGR-FLGTTCYDHSWRLWD 336

Query: 121 LCTKSVSYIKYPKACQQG---LTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTD 177
           L  +    I + +   +G   L F  DG   +LA       +  ++     + +   +  
Sbjct: 337 LEVQ--EEILHQEGHSKGVHDLHFHPDG---SLAGTGGLDSFARVWDLRTGRCVMFLEGH 391

Query: 178 TQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSS-Q 236
            +++  I ++PNG  +A        KV  + L  R          +L + SV + P+   
Sbjct: 392 IKEIYSINFSPNGFHVATGSGDNACKV--WDLRQRRCIYTIPAHQNL-VSSVKFQPNDGH 448

Query: 237 FLAIGSYDGKVRLLNHVTWK-MITEFGHPATI 267
           +L  G+YD   ++  H  W  + T  GH   +
Sbjct: 449 YLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKV 480


>ref|NP_998212.1| periodic tryptophan protein 2 homolog [Danio rerio]
          Length = 937

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 90/222 (40%), Gaps = 44/222 (19%)

Query: 226 IKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPLLG 285
           + S+A+SP  Q+LA G  DGKV++ N  +      F   ++                  G
Sbjct: 388 MNSLAYSPDGQYLATGGDDGKVKVWNTNSGLCFVTFTEHSS------------------G 429

Query: 286 LGHLSFPPPR--AMAGALSTSESKYEIA--SGPVSLQTLKPVADRANPRMGVGML--AFS 339
           +  ++F       ++ +L  +   +++       ++ + +P    +    G G L  A S
Sbjct: 430 VTEVAFTSSGFVVVSASLDGTVRAFDLHRYRNFRTMTSPRPAQFSSLAVDGSGELVCAGS 489

Query: 340 SDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQPRLAICTGGSKVY 398
            DS+            +++W +Q  +L  VL  H  PV +  + P Q  LA  +    V 
Sbjct: 490 QDSF-----------EIFLWSMQTGRLLEVLSGHEGPVSNLCFSPVQSVLASVSWDKTVR 538

Query: 399 LWSPAGC----VSVQVPGEGDFPVLGLCWHLSGDSLALLSKD 436
           LW          ++Q+  +G    L + +H +G  LA+ S D
Sbjct: 539 LWDMLDSWQTKETLQLTSDG----LAVTYHPNGMELAVASLD 576


>ref|NP_001017766.1| polycomb protein eed [Danio rerio]
          Length = 426

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 212 RLLSAYCAYEWSLGIKSVAW----SPSSQFLAIGSYDGKVRLLNHVTWKMITEF-GHPAT 266
           RLL +Y   +      + AW    S S   LA+    G +R++NH+T + +  + GH   
Sbjct: 118 RLLQSYVDADADENFYTCAWTFDCSSSHPLLAVAGSRGIIRIINHITMQCVKHYVGHGNA 177

Query: 267 INNPK 271
           IN  K
Sbjct: 178 INELK 182


>ref|NP_998264.1| WD repeat-containing protein 5 [Danio rerio]
          Length = 334

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 103/237 (43%), Gaps = 31/237 (13%)

Query: 2   NFSESFKLSGLL-----CRFSPDGKYLASCVQYRLV----IRDVTTLQILQLYTCLDQIQ 52
           N++  F L+G        +FSP G++LAS    +L+      D    + +  +     I 
Sbjct: 34  NYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKL--GIS 91

Query: 53  HIEWSADSLFILCAMYRRGLVQVWSLEQPEWHC-KIDEGSAGLVASCWSPDGRHILNTTE 111
            + WS+DS  ++ A   + L ++W +   +  C K  +G +  V  C      +++ +  
Sbjct: 92  DVAWSSDSNLLVSASDDKTL-KIWDVSSGK--CLKTLKGHSNYVFCCNFNPQSNLIVSGS 148

Query: 112 FHLRITVWSL----CTKSVSYIKYPKACQQGLTFTRDGRYLALAERRD--CRDYVSIFVC 165
           F   + +W +    C K++     P +    + F RDG  L ++   D  CR    I+  
Sbjct: 149 FDESVRIWDVKTGKCLKTLPAHSDPVS---AVHFNRDGS-LIVSSSYDGLCR----IWDT 200

Query: 166 SDWQLLRHF-DTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYE 221
           +  Q L+   D D   ++ ++++PNG  + A       K+  YS  G+ L  Y  ++
Sbjct: 201 ASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYS-KGKCLKTYTGHK 256



 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 330 RMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQPRL 388
           ++G+  +A+SSDS  L S +D+    + IWD+   K    L+ H + V    ++PQ   +
Sbjct: 87  KLGISDVAWSSDSNLLVSASDD--KTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLI 144

Query: 389 AICTGGSKVYLWS-PAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFC 439
              +    V +W    G     +P   D PV  + ++  G  +   S D  C
Sbjct: 145 VSGSFDESVRIWDVKTGKCLKTLPAHSD-PVSAVHFNRDGSLIVSSSYDGLC 195


>ref|XP_700740.5| PREDICTED: WD repeat-containing protein 20-like [Danio rerio]
          Length = 546

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 51  IQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTT 110
           +    +S D + + C + + G ++V+  +  E    +     GL+   WSPDG+++    
Sbjct: 165 LNEFAFSPDGVHVAC-VGQDGCLRVFHFDSMELQGVMKSYFGGLLCVSWSPDGKYLATGG 223

Query: 111 EFHLRITVWSLCTKSV 126
           E  L +TVWS     V
Sbjct: 224 EDDL-VTVWSFSESRV 238


>ref|XP_692471.3| PREDICTED: transducin-like enhancer protein 1 [Danio rerio]
          Length = 721

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 88/201 (43%), Gaps = 33/201 (16%)

Query: 70  RGLVQVWSLEQPEWHCKIDE----GSAGLVASCWS-PDGRHILNTTEFHLRITVWSLCTK 124
           +G V+VW + QP     + +         + SC   PDGR ++   E    +++W L T 
Sbjct: 506 KGCVKVWDISQPGSKSPMAQLDCLNRDNYIRSCKILPDGRTLIVGGEAST-LSIWDLATP 564

Query: 125 SVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQ----------LLRHF 174
           +      P+  +  LT +    Y ALA   D  + V    CSD            L+R F
Sbjct: 565 T------PR-IKAELTSSAPACY-ALAISPD--NKVCFSCCSDGNIVVWDLHNQTLVRQF 614

Query: 175 DTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSL-DGRLLSAYCAYEWSLGIKSVAWSP 233
              T   + I+ + +G  L  W   L+  V  + L +GR L     ++++  I S+ + P
Sbjct: 615 QGHTDGASCIDISNDGTKL--WTGGLDNTVRCWDLREGRQLQ---QHDFTSQIFSLGYCP 669

Query: 234 SSQFLAIGSYDGKVRLLNHVT 254
           + ++LA+G     V +L HV+
Sbjct: 670 TGEWLAVGMESSNVEVL-HVS 689


>ref|NP_001189371.1| WD repeat-containing protein 26 [Danio rerio]
          Length = 576

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 332 GVGMLAFSSDSYFLASRNDNVPNAVWIWDIQ--KLKLFVVLEHMSPVRSFQWDPQQPRLA 389
           GV  LA+S D  +L +   +  + +W+W++Q  +L+  +   H   + S  W+P   R  
Sbjct: 315 GVSYLAWSPDDVYLIACGPDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFV 374

Query: 390 ICTGGSK 396
             TGG +
Sbjct: 375 --TGGQR 379


>ref|NP_001008625.1| intraflagellar transport protein 80 homolog [Danio rerio]
          Length = 777

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 184 IEW-APNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGS 242
           ++W A N  +L+  + C +YKV  +   GRLL +   +++   I SVAW+P  +  A+GS
Sbjct: 194 VDWSAVNDLILSGGEDC-KYKV--WDSYGRLLFSSAPHDYP--ITSVAWAPDGELFAMGS 248

Query: 243 YDGKVRLLNHVTW 255
           +   +RL +   W
Sbjct: 249 FH-TLRLCDKTGW 260


>ref|NP_001181857.1| WD repeat-containing protein 33 isoform 1 [Danio rerio]
          Length = 1102

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 12/109 (11%)

Query: 340 SDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQPRLAICTGGSK-- 396
           +D+ F    +D     V IWD  +     +L  H + V+   W P +    +   GSK  
Sbjct: 213 TDNKFATCSDDGT---VRIWDFLRCHEERILRGHGADVKCVDWHPTK---GLVVSGSKDS 266

Query: 397 ---VYLWSPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFCLCF 442
              +  W P    S+         V+ + W+L+G+ L   S+DH C  F
Sbjct: 267 QQPIKFWDPKTGQSLATLHAHKNTVMEVKWNLNGNWLLTASRDHLCKLF 315


>ref|NP_998177.1| chromatin assembly factor 1 subunit B [Danio rerio]
          Length = 236

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 336 LAFSSDSYFLASRNDNVPNAVWIWDIQK-LKLFVVLEHMSPVRSFQWDP 383
           ++++SD  F+AS   +V N   +WD+ K  K+ +  +H S V+   WDP
Sbjct: 136 ISWTSDGNFMAS--GSVDNTAIMWDVNKGQKMCIFNDHKSYVQGVAWDP 182


>ref|NP_991272.1| mitotic checkpoint protein BUB3 [Danio rerio]
          Length = 326

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 226 IKSVAWSPSS-QFLAIGSYDGKVRLLNHVTWKMITEFGHPATI 267
           + +V +SPSS QFL + S+DG VRL +     M  ++ H A +
Sbjct: 17  VSAVKFSPSSSQFLLVSSWDGSVRLYDASANSMRMKYQHLAPV 59


>ref|NP_998321.1| actin-related protein 2/3 complex subunit 1B [Danio rerio]
          Length = 369

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 18/40 (45%)

Query: 365 KLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWSPAG 404
           K+ V+ EH   V    W P+  R+  C      Y+W+  G
Sbjct: 44  KIHVLKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKG 83


>ref|XP_696012.3| PREDICTED: sperm-associated antigen 5 [Danio rerio]
          Length = 1532

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 263 HPATINNPKTVVYKEAEKSPLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKP 322
           H  +  NP + ++ E  +SP+        PPP   + +L  + S   + S P   + +KP
Sbjct: 557 HDPSAENPMSHLWPELPESPM--------PPPLLNSTSLVNAFSYTPVPSDPPKKKDVKP 608

Query: 323 VADRAN 328
            AD  N
Sbjct: 609 SADHQN 614


>ref|NP_001076463.1| F-box-like/WD repeat-containing protein TBL1X [Danio rerio]
          Length = 510

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 82/213 (38%), Gaps = 28/213 (13%)

Query: 51  IQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTT 110
           +  ++W+++   +    Y  G  ++W+ +       + +    + A  W+  G  IL+  
Sbjct: 224 VTSLDWNSEGTLLATGSYD-GFARIWT-KDGNLSSTLGQHKGPIFALKWNKKGNSILSAG 281

Query: 111 EFHLRITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVC--SDW 168
                I +W   T      ++P      L    D  +   +    C   + I VC     
Sbjct: 282 VDKTTI-IWDAHTGEAKQ-QFPFHSAPAL----DVDWQNNSTFASCSTDMCIHVCRLGSE 335

Query: 169 QLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEW---SLG 225
           + L+ F   T ++  I+W P+G +LA+    +  K+     D       C ++    S  
Sbjct: 336 RPLKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDS------CVHDLQAHSKE 389

Query: 226 IKSVAWSPS---------SQFLAIGSYDGKVRL 249
           I ++ WSP+         +  LA  S+D  VRL
Sbjct: 390 IYTIKWSPTGIGSNNPNANILLASASFDSTVRL 422



 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 188 PNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKV 247
           PN  +L A     +  V L+ +D R +  +        + SVA+SP  +FLA GS+D  V
Sbjct: 405 PNANILLA-SASFDSTVRLWDVD-RGVCTHTLTRHQEPVYSVAFSPDGKFLASGSFDKCV 462

Query: 248 RLLNHVTWKMITEF 261
            + + ++  ++  +
Sbjct: 463 HIWDTMSGSLVNSY 476


>ref|XP_001345204.3| PREDICTED: WD repeat-containing protein 65-like [Danio rerio]
          Length = 686

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 336 LAFSSDSYFLASRNDNVPN---AVWIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICT 392
           +AFS DS +L  +    P+    +W+W+ +K+   V + +  P+    ++PQ     IC 
Sbjct: 111 MAFSPDSKYLIGQAGG-PDWTLFLWMWEKKKVMATVNISNNGPINQVSFNPQDNS-KICV 168

Query: 393 GGSKVY 398
            G  V+
Sbjct: 169 SGKGVF 174


>ref|NP_956412.1| POC1 centriolar protein homolog B [Danio rerio]
          Length = 490

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 64/148 (43%), Gaps = 23/148 (15%)

Query: 14  CRFSPDGKYLASCVQYRLV-IRDVTTLQILQLYTCLDQIQHIEWSADSLFI--------L 64
            RFSPDG+ +ASC   R V + D ++ Q   ++T        ++   + F+        +
Sbjct: 150 ARFSPDGRLIASCGDDRTVRLWDTSSHQCTNIFT--------DYGGSATFVDFNSSGTCI 201

Query: 65  CAMYRRGLVQVWSLEQPE--WHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLC 122
            +      +++W +   +   H K+   +AG+    + P G ++++ +     I +  L 
Sbjct: 202 ASSGADNTIKIWDIRTNKLIQHYKVH--NAGVNCFSFHPSGNYLISGSS-DSTIKILDLL 258

Query: 123 TKSVSYIKY-PKACQQGLTFTRDGRYLA 149
              + Y  +  K     +TF+RDG   A
Sbjct: 259 EGRLIYTLHGHKGPVLTVTFSRDGDLFA 286



 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 333 VGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLK-LFVVLEHMSPVRSFQWDPQQPRLAIC 391
           V  + FS D   L + +D+   +V +W +++ K L+ +  H + VR  ++ P    +A C
Sbjct: 105 VRSVNFSRDGQRLVTASDD--KSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASC 162

Query: 392 TGGSKVYLW--SPAGCVSVQVPGEG-----DFPVLGLCWHLSG 427
                V LW  S   C ++     G     DF   G C   SG
Sbjct: 163 GDDRTVRLWDTSSHQCTNIFTDYGGSATFVDFNSSGTCIASSG 205


>ref|NP_001071237.1| WD repeat, SAM and U-box domain-containing protein 1 [Danio rerio]
          Length = 487

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 4/71 (5%)

Query: 332 GVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLEH--MSPVRSFQWDPQQPRLA 389
           GV    FS+   +LAS + +    VW  D  +++   VLEH   SPVR   + P    L 
Sbjct: 56  GVHCCCFSACGQYLASCSTDATTMVWSMDTGEIE--AVLEHPGRSPVRVCAFSPDSSHLV 113

Query: 390 ICTGGSKVYLW 400
                  + LW
Sbjct: 114 SGGSDGSIALW 124


>ref|XP_001342078.1| PREDICTED: probable G-protein coupled receptor-like [Danio rerio]
          Length = 437

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%)

Query: 270 PKTVVYKEAEKSPLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRAN 328
           P      E E +  L  GH    PP    G++S  +S+    SG V + TL  +A  AN
Sbjct: 8   PAAAELNETELNETLTHGHPIHLPPSMQLGSMSNPQSRLRDMSGLVVMVTLNAIALIAN 66


>ref|XP_002663392.1| PREDICTED: uncharacterized protein C3orf38 [Danio rerio]
          Length = 285

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 381 WDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDH 437
           W+    RL +CTG  +V  +S A  VS ++    +   L  C +L G  L  +S  H
Sbjct: 157 WENVSLRLLLCTGEQRVDEFSGAELVSKRLQALAEEERLLFCPNLEGHGLKCMSSPH 213


>ref|NP_001007403.1| transducin beta-like protein 3 [Danio rerio]
          Length = 897

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 179 QDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFL 238
           +D+  +  +PN  +LA+       K+   S D RLL     +    G+ SV +SP  Q L
Sbjct: 485 KDVNSVCVSPNDKLLASGSQDRTAKLWALS-DLRLLGVCRGHR--RGVWSVQFSPVDQIL 541

Query: 239 AIGSYDGKVRLLNHVTWKMITEF-GHPATI 267
              S DG VR+ +   +  +  F GH A++
Sbjct: 542 GSASADGSVRIWSIQDFSCLKTFEGHDASV 571


>ref|NP_958500.1| actin-related protein 2/3 complex subunit 1A [Danio rerio]
          Length = 370

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 18/40 (45%)

Query: 362 QKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWS 401
           Q +K+  + EH   +    W P+  R+  C      Y+WS
Sbjct: 41  QWVKVHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWS 80


>ref|NP_001002100.1| actin-related protein 2/3 complex subunit 1A [Danio rerio]
          Length = 357

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 9/38 (23%), Positives = 17/38 (44%)

Query: 364 LKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWS 401
           +K+  + EH   +    W P+  R+  C      Y+W+
Sbjct: 43  IKIHELTEHSGRITGIDWAPESNRIVTCASDRNAYVWT 80


>ref|XP_682841.5| PREDICTED: coronin-2A-like [Danio rerio]
          Length = 514

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 99  WSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACQQG--LTFTRDGRYLALAERRDC 156
           W P  R +L ++ +  ++ +W L +  V  I     C+    L+F  DG  LA A    C
Sbjct: 139 WHPTARDLLLSSAYDCKVFMWRLDSSDVPVIVINTHCELVLCLSFNADGSLLATA----C 194

Query: 157 RD 158
           +D
Sbjct: 195 KD 196


>ref|NP_001018176.1| WD repeat-containing protein 43 [Danio rerio]
          Length = 650

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 30/168 (17%)

Query: 10  SGLLCRFSPDG-KYLASCVQY-RLVIRDVTTLQILQLY----------TCLD-----QIQ 52
           + L C FSP   ++LA C Q  RL I +  +  + Q Y          TC+       +Q
Sbjct: 8   AALPCAFSPKSHQFLALCAQDGRLRIWNTESKTLQQEYVPSAHLSAACTCVTWGPCRAVQ 67

Query: 53  HIEW----------SADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASC-WSP 101
            +            SA+   +L      G + ++S  + + HC +D G +G V S  W P
Sbjct: 68  EVPQRKRRKCDAASSAEQSDLLALGTAAGTILIYSTLKGDLHCTLDGGHSGPVNSVQWHP 127

Query: 102 DGRHILNTTEFHLRITVWSLCTKSVSYI-KYPKACQQGLTFTRDGRYL 148
           +   +L +      I  W L T  V    K  ++    L  + DG+ L
Sbjct: 128 EDS-VLYSGSDDTHIAEWDLKTGKVCCKWKADRSAISSLCISPDGKML 174


>ref|NP_001002312.1| intraflagellar transport protein 172 homolog [Danio rerio]
          Length = 1745

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 183 GIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSA--YCAYEWSLGIKSVAWSPSSQFLAI 240
            + W  N  ++A  D     K++ Y  +G ++    Y            A SPS Q + +
Sbjct: 202 ALAWGTNSIIVAGCDK----KIVAYGKEGNVIQTFDYSRDRAEKEFTVAASSPSGQSIVV 257

Query: 241 GSYDGKVRLLNHVTWKMITEFGHPATINNPKTVV 274
           GS+D ++R+ N    K   +   P  I N  T+ 
Sbjct: 258 GSFD-RLRVFNWSPRKGTWDESSPKEIPNLYTIT 290


  Database: zebrafish.protein.faa
    Posted date:  Jun 5, 2012  5:30 PM
  Number of letters in database: 14,382,362
  Number of sequences in database:  27,291
  
Lambda     K      H
   0.319    0.132    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27291
Number of Hits to DB: 21,135,535
Number of extensions: 930643
Number of successful extensions: 2899
Number of sequences better than 10.0: 191
Number of HSP's gapped: 2825
Number of HSP's successfully gapped: 217
Length of database: 14,382,362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)

Yeah, lots of output, huh? You can control that with the '-b' and '-v' flags, which set how many matches and alignments are reported.

In [31]:
 
!blastall -i mm-first.fa -d zebrafish.protein.faa -p blastp -b 2 -v 2 -e 1e-6
BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|83029092|ref|XP_357633.3| PREDICTED: similar to Ig kappa
chain V-V region L7 precursor [Mus musculus]
         (216 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_001038873.1| uncharacterized protein LOC751695 precursor ...    74   6e-14
ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [D...    74   1e-13

>ref|NP_001038873.1| uncharacterized protein LOC751695 precursor [Danio rerio]
          Length = 238

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (52%), Gaps = 7/110 (6%)

Query: 94  LLFWTSASRCD-----IVMTQSPATLSVTPGDRVSLSCRASQS--ISDYLHWYQQKSHES 146
           +L WT A+ C      + +TQ+P+ L   PG  +++ CR S+      Y+ WY QK  E+
Sbjct: 6   ILIWTLAALCGECIGQVTVTQTPSVLLSEPGQSLTVHCRLSRDPVCCYYVSWYLQKPGEA 65

Query: 147 PRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
           P+LLI Y +                 DFTLSI+ V+ ED G YYCQ+ HS
Sbjct: 66  PKLLIYYTTVLQSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQSYHS 115


>ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [Danio rerio]
          Length = 270

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 55/96 (57%), Gaps = 5/96 (5%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSIS---DYLHWYQQKSHESPRLLIKYASQ--XXX 159
           + +TQSPA  S+T G+ +++SC+ SQ IS   D + WYQQK  E+P+LLI Y S      
Sbjct: 55  VTVTQSPAVRSITQGETLTISCKTSQPISDCNDCVSWYQQKPGETPKLLIYYISSPYSNT 114

Query: 160 XXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
                        DFTLSI+ V+ ED G YYC + H
Sbjct: 115 PSRFSGGGSDYGSDFTLSISGVQTEDAGDYYCLSYH 150


BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|70778726|ref|NP_067474.2| WD repeat domain 8 [Mus musculus]
         (462 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_956187.1| WD repeat-containing protein 8 [Danio rerio]         668   0.0  

>ref|NP_956187.1| WD repeat-containing protein 8 [Danio rerio]
          Length = 446

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 372/452 (82%), Gaps = 11/452 (2%)

Query: 1   MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLYTCLDQIQHIEWSADS 60
           MNFSE FK S  LC+ SPDGKYLA+CVQYRLV+RD+ TLQI+ LYTCLDQ+ H+EWS+DS
Sbjct: 1   MNFSEVFKQSNQLCKVSPDGKYLATCVQYRLVVRDIGTLQIVHLYTCLDQVMHMEWSSDS 60

Query: 61  LFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS 120
           LFILCA+Y+RGLVQVWSLEQP+WHCKIDEGS GLV+S WSPDGRHILNTTEF+LRITVWS
Sbjct: 61  LFILCAVYKRGLVQVWSLEQPDWHCKIDEGSIGLVSSRWSPDGRHILNTTEFNLRITVWS 120

Query: 121 LCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQD 180
           LCTKSVSYIKYPKACQ+G+ FT DGRY+ALAERRDC+DY+S+FVC DW LLRHF+++TQD
Sbjct: 121 LCTKSVSYIKYPKACQKGMDFTADGRYMALAERRDCKDYISVFVCDDWHLLRHFESETQD 180

Query: 181 LTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAI 240
           L G+EW+PNGCVLA WD CLEYK+LLYSLDGRLLS Y AYEWSLGIKSVAWSPSSQFLAI
Sbjct: 181 LAGLEWSPNGCVLAVWDNCLEYKILLYSLDGRLLSFYSAYEWSLGIKSVAWSPSSQFLAI 240

Query: 241 GSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKSPL----LGLGHLSFPPPRA 296
           GSYD KVR+LNH+TWK ITEF HPATI N K VV+KE EK P+    L +  L+      
Sbjct: 241 GSYDEKVRILNHITWKKITEFEHPATITNSKAVVFKEVEKRPVVSEDLSIRQLT------ 294

Query: 297 MAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYFLASRNDNVPNAV 356
           +  AL +++SKYEI   PV +  +KP  +RANP++G+  +AFS+D+ +LA++NDN+P ++
Sbjct: 295 VDNALFSTQSKYEITQLPVQVPVVKPDPERANPKIGISAVAFSADNRYLATKNDNMPQSL 354

Query: 357 WIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEGDF 416
           W+WD+QK  L  VLE  +PVR F WDP  PRLA+CTG +K+Y+WSPAGC+SV VP EG F
Sbjct: 355 WVWDMQKFSLLAVLEQTAPVRCFVWDPHLPRLALCTGNTKLYMWSPAGCISVTVPVEG-F 413

Query: 417 PVLGLCWHLSGDSLALLSKDHFCLCFLETKER 448
            V  L WH +G SL LLSKD  CLC+ + +E+
Sbjct: 414 QVQSLFWHCTGSSLVLLSKDQLCLCYTDAEEQ 445


  Database: zebrafish.protein.faa
    Posted date:  Jun 5, 2012  5:30 PM
  Number of letters in database: 14,382,362
  Number of sequences in database:  27,291
  
Lambda     K      H
   0.319    0.132    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27291
Number of Hits to DB: 21,135,535
Number of extensions: 930643
Number of successful extensions: 2899
Number of sequences better than 1.0e-06: 9
Number of HSP's gapped: 2886
Number of HSP's successfully gapped: 9
Length of database: 14,382,362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 119 (50.4 bits)

Much better, right?

This is generally how you control UNIX programs -- you specify parameters with '-X' and then arguments to those parameters right after.

Now, let's dump all that output into a text file using '-o':

In [32]:
 
!blastall -i mm-first.fa -d zebrafish.protein.faa -p blastp -b 2 -v 2 -o out.txt
In [33]:
 
!cat out.txt
BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|83029092|ref|XP_357633.3| PREDICTED: similar to Ig kappa
chain V-V region L7 precursor [Mus musculus]
         (216 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_001038873.1| uncharacterized protein LOC751695 precursor ...    74   6e-14
ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [D...    74   1e-13

>ref|NP_001038873.1| uncharacterized protein LOC751695 precursor [Danio rerio]
          Length = 238

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (52%), Gaps = 7/110 (6%)

Query: 94  LLFWTSASRCD-----IVMTQSPATLSVTPGDRVSLSCRASQS--ISDYLHWYQQKSHES 146
           +L WT A+ C      + +TQ+P+ L   PG  +++ CR S+      Y+ WY QK  E+
Sbjct: 6   ILIWTLAALCGECIGQVTVTQTPSVLLSEPGQSLTVHCRLSRDPVCCYYVSWYLQKPGEA 65

Query: 147 PRLLIKYASQXXXXXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGHS 196
           P+LLI Y +                 DFTLSI+ V+ ED G YYCQ+ HS
Sbjct: 66  PKLLIYYTTVLQSGTASRFSGSGSNSDFTLSISGVQTEDAGHYYCQSYHS 115


>ref|XP_002667009.2| PREDICTED: hypothetical protein LOC793066 [Danio rerio]
          Length = 270

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 55/96 (57%), Gaps = 5/96 (5%)

Query: 105 IVMTQSPATLSVTPGDRVSLSCRASQSIS---DYLHWYQQKSHESPRLLIKYASQ--XXX 159
           + +TQSPA  S+T G+ +++SC+ SQ IS   D + WYQQK  E+P+LLI Y S      
Sbjct: 55  VTVTQSPAVRSITQGETLTISCKTSQPISDCNDCVSWYQQKPGETPKLLIYYISSPYSNT 114

Query: 160 XXXXXXXXXXXXXDFTLSINSVEPEDVGVYYCQNGH 195
                        DFTLSI+ V+ ED G YYC + H
Sbjct: 115 PSRFSGGGSDYGSDFTLSISGVQTEDAGDYYCLSYH 150


BLASTP 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|70778726|ref|NP_067474.2| WD repeat domain 8 [Mus musculus]
         (462 letters)

Database: zebrafish.protein.faa 
           27,291 sequences; 14,382,362 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_001032508.1| transcription initiation factor TFIID subuni...    46   7e-05
ref|XP_001919110.3| PREDICTED: echinoderm microtubule associated...    44   2e-04

>ref|NP_001032508.1| transcription initiation factor TFIID subunit 5 [Danio rerio]
          Length = 743

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 92/197 (46%), Gaps = 20/197 (10%)

Query: 79  EQPEWHCKIDEGSAGLV-ASCWSPDGRHILNTTEFHLRITVWSLCTKS--VSYI--KYPK 133
           E+     KI  G +G V    +SPD  ++L+++E    I +WSL T +  V Y    YP 
Sbjct: 473 EKTSSESKILHGHSGPVYGVSFSPDRNYLLSSSE-DGTIRLWSLQTFTCLVGYKGHNYPV 531

Query: 134 ACQQGLTFTRDGRYLALAERRDCRDYVSIFVCSD-WQLLRHFDTDTQDLTGIEWAPNGCV 192
              Q   F+  G Y          D V+    +D +Q LR F     D+T   + PN   
Sbjct: 532 WDTQ---FSPFGYYFVSG----GHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNY 584

Query: 193 LAAWDTCLEYKVLLYS-LDGRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKVRLLN 251
           +A   +  +  V L+  L+G  +  +  ++    I S+A+SP+ +FLA GS DG+V L +
Sbjct: 585 VATGSS--DRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFSPNGKFLASGSTDGRVLLWD 640

Query: 252 HVTWKMITEF-GHPATI 267
                MI E  GH  TI
Sbjct: 641 IGHGLMIAELKGHTGTI 657


>ref|XP_001919110.3| PREDICTED: echinoderm microtubule associated protein like 6 [Danio
           rerio]
          Length = 1734

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 57/155 (36%), Gaps = 11/155 (7%)

Query: 273 VVYKEAEKSPLLGLGH------LSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADR 326
           VVY   E +    LGH      L+  P +         +  Y       +L T+  + D 
Sbjct: 45  VVYNTREHTQKFYLGHNDDIISLALHPDKIQVATGQVGKDPYICVWDSYALTTVSILRDV 104

Query: 327 ANPRMGVGMLAFSSDSYFLASRNDNVPNAVWIWDIQKLKLFVVLE-HMSPVRSFQWDPQQ 385
                GV  LAF +D   LAS   +  N V +WD +K ++      H   +    WDP  
Sbjct: 105 HT--HGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFL 162

Query: 386 PRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG 420
           P   +  G   +  W  A C +   P  G F   G
Sbjct: 163 PHRLVSCGVKHIKFW--ALCGNALTPKRGIFGKTG 195


  Database: zebrafish.protein.faa
    Posted date:  Jun 5, 2012  5:30 PM
  Number of letters in database: 14,382,362
  Number of sequences in database:  27,291
  
Lambda     K      H
   0.319    0.132    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27291
Number of Hits to DB: 21,135,535
Number of extensions: 930643
Number of successful extensions: 2899
Number of sequences better than 10.0: 191
Number of HSP's gapped: 2825
Number of HSP's successfully gapped: 217
Length of database: 14,382,362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)

OK, and now... we want to do something programmatic. We're no longer content to look at the BLAST output and drool; we want to ... I dunno, turn it into a spreadsheet.

Here's some Python code to do exactly that:

In [34]:
 
import csv
import blastparser
 
# open the output file for reading
fp = open('out.txt')
 
# send output as comma-separated values to stdout
output = csv.writer(sys.stdout)
 
# parse BLAST records
for record in blastparser.parse_fp(fp):
    for hit in record:
        for match in hit.matches:
            # output each match as a separate row
            row = [record.query_name, hit.subject_name, match.score,
                   match.expect]
            output.writerow(row)
gi|83029092|ref|XP_357633.3|,ref|NP_001038873.1|,74.3,6e-14
gi|83029092|ref|XP_357633.3|,ref|XP_002667009.2|,73.6,1e-13
gi|70778726|ref|NP_067474.2|,ref|NP_001032508.1|,45.8,7e-05
gi|70778726|ref|NP_067474.2|,ref|XP_001919110.3|,44.3,0.0002
In [35]:
 
import csv
import blastparser
 
# open the output file for reading
fp = open('out.txt')
 
# send output as comma-separated values to Dropbox/out.csv
outfp = open('/root/Dropbox/out.csv', 'wb')
output = csv.writer(outfp)
 
# parse BLAST records
for record in blastparser.parse_fp(fp):
    for hit in record:
        for match in hit.matches:
            # output each match as a separate row
            row = [record.query_name, hit.subject_name, match.score,
                   match.expect]
            output.writerow(row)
            
outfp.close()
In [36]:
 
!cat /root/Dropbox/out.csv
gi|83029092|ref|XP_357633.3|,ref|NP_001038873.1|,74.3,6e-14

gi|83029092|ref|XP_357633.3|,ref|XP_002667009.2|,73.6,1e-13

gi|70778726|ref|NP_067474.2|,ref|NP_001032508.1|,45.8,7e-05

gi|70778726|ref|NP_067474.2|,ref|XP_001919110.3|,44.3,0.0002

In [36]:
 
 
ˆ